Glyma15g41020 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g41020

Feature Type:	gene_model
Chromosome:	Gm15
Start:	48042970
stop:	48048119
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g41020

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G31320	AT	Annotation by Michelle Graham. TAIR10: LOB domain-containing protein 4 \| chr1:11213107-11214032 FORWARD LENGTH=172	SoyBase	E_val: 6.00E-68	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0009855	GO-bp	Annotation by Michelle Graham. GO Biological Process: determination of bilateral symmetry	SoyBase	N/A	ISS
GO:0009944	GO-bp	Annotation by Michelle Graham. GO Biological Process: polarity specification of adaxial/abaxial axis	SoyBase	N/A	ISS
GO:0010014	GO-bp	Annotation by Michelle Graham. GO Biological Process: meristem initiation	SoyBase	N/A	ISS
GO:0010075	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of meristem growth	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
PF03195	PFAM	Protein of unknown function DUF260	JGI		ISS
UniRef100_B9RI26	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: LOB domain-containing protein, putative n=1 Tax=Ricinus communis RepID=B9RI26_RICCO	SoyBase	E_val: 3.00E-82	ISS
UniRef100_C6TJL6	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6TJL6_SOYBN	SoyBase	E_val: 1.00E-128	ISS

Expression Patterns of Glyma15g41020

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g41020

Paralog	Evidence	Comments
Glyma08g17990	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g41020 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g258100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g41020

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g41020

Limit To All Plant Sequences

>Glyma15g41020.1   sequence type=CDS   gene model=Glyma15g41020   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGGAGAGTGGTAGAAAACAAGGTACCATGTCGCCATGTGCGGCGTGCAAGCTTCTTCGAAGGAGATGCACGCCAGATTGCGCGTTTGCTCCTTATTTTCCAGCTGATGAACCCCAGAAGTTTGATAGTGTTCACAAGGTTTTCGGGGCTAGCAATGTAAACAAAATGTTAAAGGAATTACCTGAACACCAAAGAAGTGATGCGGTTAGTTCAATGGTATATGAAGCCAAAGCCAGGGTGAGGGACCCTGTGTATGGATGTGTGGGAGCCATATCCTCTCTTCAACAACAAGTTGATGTGCTCCAAACCCAATTGGCACTGGCACAAGCAGAGGTTGTACACATGAGAATGCGCCAATTCTCACCACTATCAGATCAACAACAACAACCCTCAGTGCTTCCTGAAGCCTCCAATGCATCATCAGAGAACTTGTACCACTCAAGCAGGCTCTTGTCTTCACAAACCAAGTCCCTTTTTAGCATGGACATGGTCGTTGATCAGGCCAACATGGGGCAATCCTTGTGGTCATACTAG

Predicted protein sequences of Glyma15g41020

Limit To All Plant Sequences

>Glyma15g41020.1   sequence type=predicted peptide   gene model=Glyma15g41020   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKESGRKQGTMSPCAACKLLRRRCTPDCAFAPYFPADEPQKFDSVHKVFGASNVNKMLKELPEHQRSDAVSSMVYEAKARVRDPVYGCVGAISSLQQQVDVLQTQLALAQAEVVHMRMRQFSPLSDQQQQPSVLPEASNASSENLYHSSRLLSSQTKSLFSMDMVVDQANMGQSLWSY*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain