Report for Sequence Feature Glyma15g40911
Feature Type: gene_model
Chromosome: Gm15
Start: 47902073
stop: 47910671
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma15g40911
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G59540 AT
Annotation by Michelle Graham. TAIR10: 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein | chr5:23996293-23997576 REVERSE LENGTH=366
SoyBase E_val: 2.00E-73 ISS
GO:0010167 GO-bp
Annotation by Michelle Graham. GO Biological Process: response to nitrate
SoyBase N/A ISS
GO:0015706 GO-bp
Annotation by Michelle Graham. GO Biological Process: nitrate transport
SoyBase N/A ISS
GO:0055114 GO-bp
Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process
SoyBase N/A ISS
GO:0005737 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm
SoyBase N/A ISS
GO:0016491 GO-mf
Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity
SoyBase N/A ISS
GO:0016706 GO-mf
Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors
SoyBase N/A ISS
PTHR10209 Panther
FE(II)/ ASCORBATE OXIDASE SUPERFAMILY
JGI ISS
PTHR10209:SF55 Panther
OXIDOREDUCTASE, 2OG-FE(II) OXYGENASE FAMILY PROTEI
JGI ISS
PF03171 PFAM
2OG-Fe(II) oxygenase superfamily
JGI ISS
UniRef100_G7IH14 UniRef
Annotation by Michelle Graham. Best UniRef hit: 1-aminocyclopropane-1-carboxylate oxidase-like protein n=1 Tax=Medicago truncatula RepID=G7IH14_MEDTR
SoyBase E_val: 3.00E-97 ISS
UniRef100_G7IH14 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: 1-aminocyclopropane-1-carboxylate oxidase-like protein n=1 Tax=Medicago truncatula RepID=G7IH14_MEDTR
SoyBase E_val: 3.00E-97 ISS
Expression Patterns of Glyma15g40911
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma15g40911
Paralog Evidence Comments
Glyma08g18068 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma15g40911 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.15g257400 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma15g40911
Coding sequences of Glyma15g40911
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma15g40911.1 sequence type=CDS gene model=Glyma15g40911 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGTGATCACAAGAACAGATGAGTTGGAGGCAGGAACTGTTTCCAGTTATGACAGGATAAGTGAACTTAAGGCATTTGATGATTCAAAGGCTGGTGTCCAAGGACTGGTAGAAAATGGCATCCACGATGTTTTGCGAGATGATGTTGTGGGGAAACTTAGATATGCATGTGAAAAATGGGGCTTCTTTCAGGTCATAAACCATGGAATTCCAAGTGATGTTTTGGATGAGATGATCAAAGGTACTAGCAGGTTTCACCAACAAGACGCAAAGGCTAGGAAAGAGTACTACACCCGTGATCCGAACAGAAAAGTTGTTTATGTTTCCAATTATAGTCTATACCATGATCCTGCTGCTACTTGGAGGGACACTCTTTGTTGTGTGATGACACCTCATCCACCAGAAGCAGGAGAATTCAAGCACACAGACAATGACTTCTTAAAAATACTTTTGCAAGACCAGATAGGTGGTCTTCAAGTTCTTCATGACAACCAATGGGTTGATGTAACTCCCATCCATGGAGCCCTTGTAATAAACATTGGGGATCTTTTGCAGCTTCTTACTAATGACAAGTTCATCAGTGTTAAGCACAGAGTTTTAGCAAATCATATAGGTCCAAGAATTTCTGTTGCATCGTTGTTTAGAAAAGATGGTGATGACTCACTAGTCTATGGTCCAAACAAGGAGCTGTTATCTGAAGTAAATCCACCACTATACAGAGACGTTTCTTTAAAAGAGTACTTGACATATTATTATGCAAAGGGCATTGGAACTTCTGGACCATCACACTTCAAGTTGTGA
Predicted protein sequences of Glyma15g40911
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma15g40911.1 sequence type=predicted peptide gene model=Glyma15g40911 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MVITRTDELEAGTVSSYDRISELKAFDDSKAGVQGLVENGIHDVLRDDVVGKLRYACEKWGFFQVINHGIPSDVLDEMIKGTSRFHQQDAKARKEYYTRDPNRKVVYVSNYSLYHDPAATWRDTLCCVMTPHPPEAGEFKHTDNDFLKILLQDQIGGLQVLHDNQWVDVTPIHGALVINIGDLLQLLTNDKFISVKHRVLANHIGPRISVASLFRKDGDDSLVYGPNKELLSEVNPPLYRDVSLKEYLTYYYAKGIGTSGPSHFKL*