SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g40450

Feature Type:gene_model
Chromosome:Gm15
Start:47454287
stop:47457571
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g40450
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G79040AT Annotation by Michelle Graham. TAIR10: photosystem II subunit R | chr1:29736085-29736781 FORWARD LENGTH=140 SoyBaseE_val: 2.00E-69ISS
GO:0009637GO-bp Annotation by Michelle Graham. GO Biological Process: response to blue light SoyBaseN/AISS
GO:0009644GO-bp Annotation by Michelle Graham. GO Biological Process: response to high light intensity SoyBaseN/AISS
GO:0009744GO-bp Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus SoyBaseN/AISS
GO:0010114GO-bp Annotation by Michelle Graham. GO Biological Process: response to red light SoyBaseN/AISS
GO:0010155GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of proton transport SoyBaseN/AISS
GO:0010218GO-bp Annotation by Michelle Graham. GO Biological Process: response to far red light SoyBaseN/AISS
GO:0010270GO-bp Annotation by Michelle Graham. GO Biological Process: photosystem II oxygen evolving complex assembly SoyBaseN/AISS
GO:0015979GO-bp Annotation by Michelle Graham. GO Biological Process: photosynthesis SoyBaseN/AISS
GO:0019344GO-bp Annotation by Michelle Graham. GO Biological Process: cysteine biosynthetic process SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009523GO-cc Annotation by Michelle Graham. GO Cellular Compartment: photosystem II SoyBaseN/AISS
GO:0009534GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid SoyBaseN/AISS
GO:0009535GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane SoyBaseN/AISS
GO:0009579GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid SoyBaseN/AISS
GO:0009654GO-cc Annotation by Michelle Graham. GO Cellular Compartment: oxygen evolving complex SoyBaseN/AISS
GO:0042651GO-cc Annotation by Michelle Graham. GO Cellular Compartment: thylakoid membrane SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PF04725PFAM Photosystem II 10 kDa polypeptide PsbR JGI ISS
UniRef100_C6SWI3UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SWI3_SOYBN SoyBaseE_val: 8.00E-92ISS
UniRef100_Q2PXN6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Chloroplast photosystem II 10 kDa protein (Fragment) n=1 Tax=Arachis hypogaea RepID=Q2PXN6_ARAHY SoyBaseE_val: 2.00E-75ISS

Expression Patterns of Glyma15g40450
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g40450
ParalogEvidenceComments
Glyma08g18510 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g40450 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g253700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g40450
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g40450
>Glyma15g40450.1   sequence type=CDS   gene model=Glyma15g40450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCTCTTCAGTGATGGCATCTGTGGCCCTCAAACCTGCCCCTTTCACTGTTGAGAAGTCCTCAGTGAGAGGCCTTCCCTCTCTCTCAAGGAACTCTTCTTCATTCAGAGTTGTGGCCAGTGGCAAGAAGATCAAGACTGACAAACCTTATGGAATTAATGGTGGCATGGCTTTGAGGGATGGAACTGATGCATCTGGCAGGAAAGGAAAGGGAAAGGGTGTTTACCAGTTTGTAGACAAATACGGTGCTAATGTCGATGGTTACAGTCCTATCTACGACACCAAGGACTGGTCTCCAACCGGTGATGTCTACGCTGGCGGTACGACTGGCTTGGCTATCTGGGCTGTGACTCTACTTGGTCTTTTAGCTGGTGGTGCACTTCTTGTCTACAACACAAGTGCTTTGGTTCAATAG
Predicted protein sequences of Glyma15g40450
>Glyma15g40450.1   sequence type=predicted peptide   gene model=Glyma15g40450   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASSVMASVALKPAPFTVEKSSVRGLPSLSRNSSSFRVVASGKKIKTDKPYGINGGMALRDGTDASGRKGKGKGVYQFVDKYGANVDGYSPIYDTKDWSPTGDVYAGGTTGLAIWAVTLLGLLAGGALLVYNTSALVQ*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo