Report for Sequence Feature Glyma15g40390
Feature Type: gene_model
Chromosome: Gm15
Start: 47366396
stop: 47371121
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma15g40390
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT5G64130 AT
Annotation by Michelle Graham. TAIR10: cAMP-regulated phosphoprotein 19-related protein | chr5:25664547-25665339 REVERSE LENGTH=115
SoyBase E_val: 4.00E-49 ISS
GO:0008150 GO-bp
Annotation by Michelle Graham. GO Biological Process: biological process
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0005737 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm
SoyBase N/A ISS
GO:0005739 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion
SoyBase N/A ISS
GO:0005886 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane
SoyBase N/A ISS
GO:0003674 GO-mf
Annotation by Michelle Graham. GO Molecular Function: molecular function
SoyBase N/A ISS
PF04667 PFAM
cAMP-regulated phosphoprotein/endosulfine conserved region
JGI ISS
UniRef100_I1MJ45 UniRef
Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MJ45_SOYBN
SoyBase E_val: 1.00E-78 ISS
UniRef100_Q93Z49 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: AT5g64130/MHJ24_11 n=1 Tax=Arabidopsis thaliana RepID=Q93Z49_ARATH
SoyBase E_val: 2.00E-46 ISS
Expression Patterns of Glyma15g40390
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma15g40390
Paralog Evidence Comments
Glyma08g18560 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma15g40390 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.15g253200 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma15g40390
Coding sequences of Glyma15g40390
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma15g40390.1 sequence type=CDS gene model=Glyma15g40390 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGTCTAACATAGAGGAGAACAAATATCTAGGACAGATGGACGTGAATGCATCTGATAAGTCAGCTAACATGCCATCATCCCAAAAGCAGGAGGAGGCTGTAAAGAAAAAGTATGGAGGAATGCTGCCCAAAAAGCCGCCACTCATATCTAAGGACCATGAGCGTGCTTACTTTGATTCTGCGGATTGGGCACTTGGAAAGCAAGGCGGAGACAAGCCTAAGGGGCCACTTGAAGCTCTTCGGCCTAAATTACAGCCGACGCAGCAGCAAACACGTTACCGGAAATCTCCATATGCTCCTTCAGGAGAAGAAGGGGGAAGTGTTCCAGCCGAGGATGTGCCTTCGAACGAGTAA
Predicted protein sequences of Glyma15g40390
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma15g40390.1 sequence type=predicted peptide gene model=Glyma15g40390 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MSNIEENKYLGQMDVNASDKSANMPSSQKQEEAVKKKYGGMLPKKPPLISKDHERAYFDSADWALGKQGGDKPKGPLEALRPKLQPTQQQTRYRKSPYAPSGEEGGSVPAEDVPSNE*