Report for Sequence Feature Glyma15g40305
Feature Type: gene_model
Chromosome: Gm15
Start: 47279168
stop: 47283870
Source: JGI
Version: Wm82.a1.v1.1
High confidence: yes
A newer version of this gene model can be found here:
Annotations for Glyma15g40305
Database ID Annotation Type Annotation Description Annotation Source Match Score Evidence Code
AT1G78370 AT
Annotation by Michelle Graham. TAIR10: glutathione S-transferase TAU 20 | chr1:29484428-29485204 REVERSE LENGTH=217
SoyBase E_val: 4.00E-28 ISS
GO:0000023 GO-bp
Annotation by Michelle Graham. GO Biological Process: maltose metabolic process
SoyBase N/A ISS
GO:0006569 GO-bp
Annotation by Michelle Graham. GO Biological Process: tryptophan catabolic process
SoyBase N/A ISS
GO:0009407 GO-bp
Annotation by Michelle Graham. GO Biological Process: toxin catabolic process
SoyBase N/A ISS
GO:0009684 GO-bp
Annotation by Michelle Graham. GO Biological Process: indoleacetic acid biosynthetic process
SoyBase N/A ISS
GO:0019252 GO-bp
Annotation by Michelle Graham. GO Biological Process: starch biosynthetic process
SoyBase N/A ISS
GO:0043085 GO-bp
Annotation by Michelle Graham. GO Biological Process: positive regulation of catalytic activity
SoyBase N/A ISS
GO:2000030 GO-bp
Annotation by Michelle Graham. GO Biological Process: regulation of response to red or far red light
SoyBase N/A ISS
GO:0005634 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: nucleus
SoyBase N/A ISS
GO:0005737 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm
SoyBase N/A ISS
GO:0009507 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: chloroplast
SoyBase N/A ISS
GO:0048046 GO-cc
Annotation by Michelle Graham. GO Cellular Compartment: apoplast
SoyBase N/A ISS
GO:0004364 GO-mf
Annotation by Michelle Graham. GO Molecular Function: glutathione transferase activity
SoyBase N/A ISS
GO:0019899 GO-mf
Annotation by Michelle Graham. GO Molecular Function: enzyme binding
SoyBase N/A ISS
PTHR11260 Panther
GLUTATHIONE S-TRANSFERASE, GST, SUPERFAMILY, GST DOMAIN CONTAINING
JGI ISS
PTHR11260:SF54 Panther
SUBFAMILY NOT NAMED
JGI ISS
PF00043 PFAM
Glutathione S-transferase, C-terminal domain
JGI ISS
UniRef100_F8UV60 UniRef
Annotation by Michelle Graham. Most informative UniRef hit: Glutathione transferase n=1 Tax=Nicotiana benthamiana RepID=F8UV60_NICBE
SoyBase E_val: 2.00E-26 ISS
UniRef100_UPI000233BE4A UniRef
Annotation by Michelle Graham. Best UniRef hit: UPI000233BE4A related cluster n=1 Tax=unknown RepID=UPI000233BE4A
SoyBase E_val: 2.00E-53 ISS
Expression Patterns of Glyma15g40305
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
To see more experiments click HERE
Paralogs of Glyma15g40305
Paralog Evidence Comments
Glyma08g18630 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.
Gene model name correspondences to Glyma15g40305 Gene Call Version Wm82.a1.v1.1
Corresponding Name Annotation Version Evidence Comments
Glyma.15g252500 Wm82.a2.v1 IGC As supplied by JGI
References for Glyma15g40305
Coding sequences of Glyma15g40305
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NT Limit To All Plant Sequences
>Glyma15g40305.1 sequence type=CDS gene model=Glyma15g40305 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
ATGGTAGACCCATATCTGAGTCCCTCATCATTCTTGAGTACATGCATTGATGAGGTTTGGAAGCAAGAAAAACAACTCTTCTCTGATGATCCTCACTACCGAGCCAGAGCCAGGTTTTGGATTGACTTGTTTGACAAGAAGATAGCAGATTATGGTATGAGACTCTGGGCTAGCAAGGGAGAAGACCAAGAGGCTGCAAAGAAAGAGTTTCTGGAGTGCATGAAACTCTTGGAAAATGAACTTAGAGACAAGCCTTATTTTGCTAGTGATTGTTTTGGCCTTTTGGATATAGACTTTACTACTAAAAAATAA
Predicted protein sequences of Glyma15g40305
Show Sequence BLAST Sequence at SoyBase BLAST Sequence against GenBank NR Limit To All Plant Sequences
>Glyma15g40305.1 sequence type=predicted peptide gene model=Glyma15g40305 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high
MVDPYLSPSSFLSTCIDEVWKQEKQLFSDDPHYRARARFWIDLFDKKIADYGMRLWASKGEDQEAAKKEFLECMKLLENELRDKPYFASDCFGLLDIDFTTKK*