Glyma15g40131 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g40131): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g40131): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g40131

Feature Type:	gene_model
Chromosome:	Gm15
Start:	47075195
stop:	47089818
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g40131

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G20890	AT	Annotation by Michelle Graham. TAIR10: photosystem II reaction center PSB29 protein \| chr2:8987783-8989185 FORWARD LENGTH=300	SoyBase	E_val: 1.00E-29	ISS
GO:0006364	GO-bp	Annotation by Michelle Graham. GO Biological Process: rRNA processing	SoyBase	N/A	ISS
GO:0006417	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of translation	SoyBase	N/A	ISS
GO:0006655	GO-bp	Annotation by Michelle Graham. GO Biological Process: phosphatidylglycerol biosynthetic process	SoyBase	N/A	ISS
GO:0007186	GO-bp	Annotation by Michelle Graham. GO Biological Process: G-protein coupled receptor signaling pathway	SoyBase	N/A	ISS
GO:0009657	GO-bp	Annotation by Michelle Graham. GO Biological Process: plastid organization	SoyBase	N/A	ISS
GO:0009773	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem I	SoyBase	N/A	ISS
GO:0009902	GO-bp	Annotation by Michelle Graham. GO Biological Process: chloroplast relocation	SoyBase	N/A	ISS
GO:0010027	GO-bp	Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization	SoyBase	N/A	ISS
GO:0010182	GO-bp	Annotation by Michelle Graham. GO Biological Process: sugar mediated signaling pathway	SoyBase	N/A	ISS
GO:0010207	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosystem II assembly	SoyBase	N/A	ISS
GO:0015979	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis	SoyBase	N/A	ISS
GO:0019288	GO-bp	Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway	SoyBase	N/A	ISS
GO:0034660	GO-bp	Annotation by Michelle Graham. GO Biological Process: ncRNA metabolic process	SoyBase	N/A	ISS
GO:0035304	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation	SoyBase	N/A	ISS
GO:0042742	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response to bacterium	SoyBase	N/A	ISS
GO:0042793	GO-bp	Annotation by Michelle Graham. GO Biological Process: transcription from plastid promoter	SoyBase	N/A	ISS
GO:0045037	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein import into chloroplast stroma	SoyBase	N/A	ISS
GO:0045038	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein import into chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0045893	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009527	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastid outer membrane	SoyBase	N/A	ISS
GO:0009528	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastid inner membrane	SoyBase	N/A	ISS
GO:0009532	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plastid stroma	SoyBase	N/A	ISS
GO:0009534	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid	SoyBase	N/A	ISS
GO:0009535	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0010319	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: stromule	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
PF11264	PFAM	Thylakoid formation protein	JGI		ISS
UniRef100_Q84PB7	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Protein THYLAKOID FORMATION1, chloroplastic n=2 Tax=Oryza sativa Japonica Group RepID=THF1_ORYSJ	SoyBase	E_val: 2.00E-30	ISS
UniRef100_UPI000233BE46	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233BE46 related cluster n=1 Tax=unknown RepID=UPI000233BE46	SoyBase	E_val: 2.00E-40	ISS

Expression Patterns of Glyma15g40131

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g40131 not represented in the dataset	Glyma15g40131 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g40131 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma15g40131

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g40131

Limit To All Plant Sequences

>Glyma15g40131.1   sequence type=CDS   gene model=Glyma15g40131   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCACGAAAGTTGGAAGAGTGGGCTGGAGTTCAAAATCCAACTTCTCTTGTTGAGTTTTCATCCAAAGAAGGAGAAGCTGAGAAGATTTAAAGGACATTGCATAAAGGGCTGGGGGGAAGGGGAATTCAGTTATAGTCGTTTCTTTGCAGTTGGACTCTTTCGTCTAGTTGAGTTGGAAAATGCCACAGAACCAATAATTTTGGACAAGCTTTGTGCGGCTTTGAACATCAACAAAAGAAGTGTTGATTGGGACTTGGATGTGTATTGTATCCTGCTTTCAGAATTGCTTCAAGTAAAAGAGTTGCTGAAGGAGTATATTGACAAATGA

Predicted protein sequences of Glyma15g40131

Limit To All Plant Sequences

>Glyma15g40131.1   sequence type=predicted peptide   gene model=Glyma15g40131   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHESWKSGLEFKIQLLLLSFHPKKEKLRRFKGHCIKGWGEGEFSYSRFFAVGLFRLVELENATEPIILDKLCAALNINKRSVDWDLDVYCILLSELLQVKELLKEYIDK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain