|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT2G20890 | AT | Annotation by Michelle Graham. TAIR10: photosystem II reaction center PSB29 protein | chr2:8987783-8989185 FORWARD LENGTH=300 | SoyBase | E_val: 1.00E-29 | ISS |
GO:0006364 | GO-bp | Annotation by Michelle Graham. GO Biological Process: rRNA processing | SoyBase | N/A | ISS |
GO:0006417 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of translation | SoyBase | N/A | ISS |
GO:0006655 | GO-bp | Annotation by Michelle Graham. GO Biological Process: phosphatidylglycerol biosynthetic process | SoyBase | N/A | ISS |
GO:0007186 | GO-bp | Annotation by Michelle Graham. GO Biological Process: G-protein coupled receptor signaling pathway | SoyBase | N/A | ISS |
GO:0009657 | GO-bp | Annotation by Michelle Graham. GO Biological Process: plastid organization | SoyBase | N/A | ISS |
GO:0009773 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport in photosystem I | SoyBase | N/A | ISS |
GO:0009902 | GO-bp | Annotation by Michelle Graham. GO Biological Process: chloroplast relocation | SoyBase | N/A | ISS |
GO:0010027 | GO-bp | Annotation by Michelle Graham. GO Biological Process: thylakoid membrane organization | SoyBase | N/A | ISS |
GO:0010182 | GO-bp | Annotation by Michelle Graham. GO Biological Process: sugar mediated signaling pathway | SoyBase | N/A | ISS |
GO:0010207 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosystem II assembly | SoyBase | N/A | ISS |
GO:0015979 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis | SoyBase | N/A | ISS |
GO:0019288 | GO-bp | Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway | SoyBase | N/A | ISS |
GO:0034660 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ncRNA metabolic process | SoyBase | N/A | ISS |
GO:0035304 | GO-bp | Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation | SoyBase | N/A | ISS |
GO:0042742 | GO-bp | Annotation by Michelle Graham. GO Biological Process: defense response to bacterium | SoyBase | N/A | ISS |
GO:0042793 | GO-bp | Annotation by Michelle Graham. GO Biological Process: transcription from plastid promoter | SoyBase | N/A | ISS |
GO:0045037 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein import into chloroplast stroma | SoyBase | N/A | ISS |
GO:0045038 | GO-bp | Annotation by Michelle Graham. GO Biological Process: protein import into chloroplast thylakoid membrane | SoyBase | N/A | ISS |
GO:0045893 | GO-bp | Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent | SoyBase | N/A | ISS |
GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
GO:0009527 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plastid outer membrane | SoyBase | N/A | ISS |
GO:0009528 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plastid inner membrane | SoyBase | N/A | ISS |
GO:0009532 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: plastid stroma | SoyBase | N/A | ISS |
GO:0009534 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid | SoyBase | N/A | ISS |
GO:0009535 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane | SoyBase | N/A | ISS |
GO:0009570 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma | SoyBase | N/A | ISS |
GO:0009941 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope | SoyBase | N/A | ISS |
GO:0010319 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: stromule | SoyBase | N/A | ISS |
GO:0003674 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: molecular function | SoyBase | N/A | ISS |
GO:0005515 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: protein binding | SoyBase | N/A | ISS |
PF11264 | PFAM | Thylakoid formation protein | JGI | ISS | |
UniRef100_Q84PB7 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Protein THYLAKOID FORMATION1, chloroplastic n=2 Tax=Oryza sativa Japonica Group RepID=THF1_ORYSJ | SoyBase | E_val: 2.00E-30 | ISS |
UniRef100_UPI000233BE46 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233BE46 related cluster n=1 Tax=unknown RepID=UPI000233BE46 | SoyBase | E_val: 2.00E-40 | ISS |
Glyma15g40131 not represented in the dataset |
Glyma15g40131 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma15g40131.1 sequence type=CDS gene model=Glyma15g40131 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGCACGAAAGTTGGAAGAGTGGGCTGGAGTTCAAAATCCAACTTCTCTTGTTGAGTTTTCATCCAAAGAAGGAGAAGCTGAGAAGATTTAAAGGACATTGCATAAAGGGCTGGGGGGAAGGGGAATTCAGTTATAGTCGTTTCTTTGCAGTTGGACTCTTTCGTCTAGTTGAGTTGGAAAATGCCACAGAACCAATAATTTTGGACAAGCTTTGTGCGGCTTTGAACATCAACAAAAGAAGTGTTGATTGGGACTTGGATGTGTATTGTATCCTGCTTTCAGAATTGCTTCAAGTAAAAGAGTTGCTGAAGGAGTATATTGACAAATGA
>Glyma15g40131.1 sequence type=predicted peptide gene model=Glyma15g40131 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MHESWKSGLEFKIQLLLLSFHPKKEKLRRFKGHCIKGWGEGEFSYSRFFAVGLFRLVELENATEPIILDKLCAALNINKRSVDWDLDVYCILLSELLQVKELLKEYIDK*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||