Glyma15g40100 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g40100

Feature Type:	gene_model
Chromosome:	Gm15
Start:	47050346
stop:	47054357
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g40100

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G80245	AT	Annotation by Michelle Graham. TAIR10: Spc97 / Spc98 family of spindle pole body (SBP) component \| chr1:30174547-30175217 FORWARD LENGTH=127	SoyBase	E_val: 5.00E-27	ISS
GO:0000226	GO-bp	Annotation by Michelle Graham. GO Biological Process: microtubule cytoskeleton organization	SoyBase	N/A	ISS
GO:0006626	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PTHR19302	Panther	GAMMA TUBULIN COMPLEX PROTEIN	JGI		ISS
PTHR19302:SF30	Panther	UNKNOWN PROTEIN	JGI		ISS
UniRef100_I1MJ27	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MJ27_SOYBN	SoyBase	E_val: 4.00E-103	ISS

Expression Patterns of Glyma15g40100

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g40100

Paralog	Evidence	Comments
Glyma08g18781	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g40100 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g250400	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g40100

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g40100

Limit To All Plant Sequences

>Glyma15g40100.2   sequence type=CDS   gene model=Glyma15g40100   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGGACAGACACTTGAAGAAAAGAATCAAAAGATTGAAAGACATGGTTGAGCCAGATAAAAATTGCGAGACTAGGGTTGAAGATGTTGCTTGGCTTTGCTCCCTTTCAGAGTCTGAGATTGACATGCTGATTAGCTTGAAACTGTTGATCATTCAGCGTGCAAAAATGATGGGTTGTAAGGAGCTGGCTAGTAAATTCAACCTTAAAATGATTCGAGCCATTGCACTTGTTTTGATGGGCCATCTGAAGGAAGAGATAAAAGATTCATCACTTATCCCCAATATGGTTAAATCTACTTCTTTTTTAGATGCTTGCAACCTATTGAAATGTAGCAATGAGGTTGATGCAAATATTGATGAGCTAAGTACAAGTCTTGGTGCTGATATAGAAACTTTTCTTAGAAGTCCTCCAACATCCAAACAAAAGAAGCAGAAAGTTGGAAGCCGAGAATGA

Predicted protein sequences of Glyma15g40100

Limit To All Plant Sequences

>Glyma15g40100.2   sequence type=predicted peptide   gene model=Glyma15g40100   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKDRHLKKRIKRLKDMVEPDKNCETRVEDVAWLCSLSESEIDMLISLKLLIIQRAKMMGCKELASKFNLKMIRAIALVLMGHLKEEIKDSSLIPNMVKSTSFLDACNLLKCSNEVDANIDELSTSLGADIETFLRSPPTSKQKKQKVGSRE*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain