Glyma15g39619 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g39619): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g39619): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g39619

Feature Type:	gene_model
Chromosome:	Gm15
Start:	46430944
stop:	46436951
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g39619

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G05660	AT	Annotation by Michelle Graham. TAIR10: receptor like protein 33 \| chr3:1649258-1652001 REVERSE LENGTH=875	SoyBase	E_val: 5.00E-26	ISS
GO:0000165	GO-bp	Annotation by Michelle Graham. GO Biological Process: MAPK cascade	SoyBase	N/A	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0006457	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein folding	SoyBase	N/A	ISS
GO:0006612	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to membrane	SoyBase	N/A	ISS
GO:0006952	GO-bp	Annotation by Michelle Graham. GO Biological Process: defense response	SoyBase	N/A	ISS
GO:0007165	GO-bp	Annotation by Michelle Graham. GO Biological Process: signal transduction	SoyBase	N/A	ISS
GO:0009408	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to heat	SoyBase	N/A	ISS
GO:0009617	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to bacterium	SoyBase	N/A	ISS
GO:0009644	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to high light intensity	SoyBase	N/A	ISS
GO:0009862	GO-bp	Annotation by Michelle Graham. GO Biological Process: systemic acquired resistance, salicylic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0009867	GO-bp	Annotation by Michelle Graham. GO Biological Process: jasmonic acid mediated signaling pathway	SoyBase	N/A	ISS
GO:0010310	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of hydrogen peroxide metabolic process	SoyBase	N/A	ISS
GO:0010363	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of plant-type hypersensitive response	SoyBase	N/A	ISS
GO:0031348	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of defense response	SoyBase	N/A	ISS
GO:0034976	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to endoplasmic reticulum stress	SoyBase	N/A	ISS
GO:0035304	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of protein dephosphorylation	SoyBase	N/A	ISS
GO:0042542	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to hydrogen peroxide	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0016301	GO-mf	Annotation by Michelle Graham. GO Molecular Function: kinase activity	SoyBase	N/A	ISS
PTHR24420	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24420:SF478	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00560	PFAM	Leucine Rich Repeat	JGI		ISS
UniRef100_G7ZXR5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Receptor-like kinase n=1 Tax=Medicago truncatula RepID=G7ZXR5_MEDTR	SoyBase	E_val: 7.00E-70	ISS
UniRef100_UPI000233847B	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233847B related cluster n=1 Tax=unknown RepID=UPI000233847B	SoyBase	E_val: 8.00E-105	ISS

Expression Patterns of Glyma15g39619

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g39619 not represented in the dataset	Glyma15g39619 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g39619 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g247500	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g39619

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g39619

Limit To All Plant Sequences

>Glyma15g39619.1   sequence type=CDS   gene model=Glyma15g39619   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCCTCAAATGTTTATGACTCTAATGTGTTATTGATGTGGAAGGGTCAGGAATATTTGTATTTGAATCCTGAGTTTCTTTTGAAGAGCATTGATCTCTCAAGTAATGATTTAACAGGTGAAATACCAAAGGAGGTAAGATATTTACTTGAATTAGTTTCTTTGAATTTATCAAGAAATAGATTAAGTGGAGAAATTCTTCCTGAGATTGGGAATTTAACTTCACTAGAGTTTCTTGATTTATCAAGAAATCATTTCTCTGGTGAAGTTCCTTCTACTTTTTCCAAAATTGATCGTTTTGTCGTGTTAGACTTATCTAACAACTATCTTGTTGGAAGAATCCCCTGGGGAAGACAGCTTCAGACCTTTAGTGCCTCTACTTTTGAAGGAAATACCGATCTTTGTGGTGAACCACTTAACAAAAGCTTCCCTGGAAATGACACAGCAACAAAGCCTCAAGGACCAGCAATTCATGGTGATGATGACAATTCAATTTTCTATGATGCATTATACATGAGCTTGGGGTTAGGATTCTTCACAGGCTTTTGGCGCTTAATAGGTACAATACCACTTTGGCAATCGTGCAGAAATGCTTACCTGATGTTCTTAAACAAACGGACAGAATATATATTAGTAATGGTTGAAGTGAACATAGCAAAGTGCCATAGGTGGCTCAAGGGCTAG

Predicted protein sequences of Glyma15g39619

Limit To All Plant Sequences

>Glyma15g39619.1   sequence type=predicted peptide   gene model=Glyma15g39619   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSSNVYDSNVLLMWKGQEYLYLNPEFLLKSIDLSSNDLTGEIPKEVRYLLELVSLNLSRNRLSGEILPEIGNLTSLEFLDLSRNHFSGEVPSTFSKIDRFVVLDLSNNYLVGRIPWGRQLQTFSASTFEGNTDLCGEPLNKSFPGNDTATKPQGPAIHGDDDNSIFYDALYMSLGLGFFTGFWRLIGTIPLWQSCRNAYLMFLNKRTEYILVMVEVNIAKCHRWLKG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain