Glyma15g39550 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g39550): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g39550): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g39550

Feature Type:	gene_model
Chromosome:	Gm15
Start:	46232051
stop:	46232545
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g39550

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G20090	AT	Annotation by Michelle Graham. TAIR10: Uncharacterised protein family (UPF0041) \| chr5:6787246-6788000 REVERSE LENGTH=110	SoyBase	E_val: 3.00E-48	ISS
GO:0006096	GO-bp	Annotation by Michelle Graham. GO Biological Process: glycolysis	SoyBase	N/A	ISS
GO:0006301	GO-bp	Annotation by Michelle Graham. GO Biological Process: postreplication repair	SoyBase	N/A	ISS
GO:0008150	GO-bp	Annotation by Michelle Graham. GO Biological Process: biological process	SoyBase	N/A	ISS
GO:0009060	GO-bp	Annotation by Michelle Graham. GO Biological Process: aerobic respiration	SoyBase	N/A	ISS
GO:0046686	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cadmium ion	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005774	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
KOG1589	KOG	Uncharacterized conserved protein	JGI		ISS
PTHR14154	Panther	UPF0041 BRAIN PROTEIN 44-RELATED	JGI		ISS
PTHR14154:SF3	Panther	UNCHARACTERIZED	JGI		ISS
PF03650	PFAM	Uncharacterised protein family (UPF0041)	JGI		ISS
UniRef100_B9RAJ4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Brain protein, putative n=1 Tax=Ricinus communis RepID=B9RAJ4_RICCO	SoyBase	E_val: 3.00E-49	ISS
UniRef100_I1MJ03	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1MJ03_SOYBN	SoyBase	E_val: 3.00E-59	ISS

Expression Patterns of Glyma15g39550

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g39550 not represented in the dataset	Glyma15g39550 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g39550 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g246900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g39550

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g39550

Limit To All Plant Sequences

>Glyma15g39550.1   sequence type=CDS   gene model=Glyma15g39550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCTCCTTTAGAGCATTCTGGAACAGTCTAGTTGGTCCCAAAACAACTCACTTTTGGGGACCTATTGCCAACTGGGGATTCGTGGCAGCTGGATTGGCTAACTTGAACAAACCTCCAGAAATGATCTCTGGCAACATGACAGGAGCAATGTGTGTCTATTCAACATTGTTCATGAGATTCGCATGGATGGTACAGCCACACAACTATCTACTTTTTGCCTATCATGCCTCAAATGAGATTGTTCAACTCTATCACTTCTCTCGATAG

Predicted protein sequences of Glyma15g39550

Limit To All Plant Sequences

>Glyma15g39550.1   sequence type=predicted peptide   gene model=Glyma15g39550   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MASFRAFWNSLVGPKTTHFWGPIANWGFVAAGLANLNKPPEMISGNMTGAMCVYSTLFMRFAWMVQPHNYLLFAYHASNEIVQLYHFSR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain