SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g39515

Feature Type:gene_model
Chromosome:Gm15
Start:46173151
stop:46176297
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g39515
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G40480AT Annotation by Michelle Graham. TAIR10: embryo defective 3012 | chr5:16213361-16223982 FORWARD LENGTH=1923 SoyBaseE_val: 9.00E-17ISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005635GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nuclear envelope SoyBaseN/AISS
GO:0005783GO-cc Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
UniRef100_I1K1L5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1K1L5_SOYBN SoyBaseE_val: 2.00E-30ISS
UniRef100_Q9FI62UniRef Annotation by Michelle Graham. Most informative UniRef hit: Nuclear pore protein-like n=1 Tax=Arabidopsis thaliana RepID=Q9FI62_ARATH SoyBaseE_val: 4.00E-14ISS

Expression Patterns of Glyma15g39515
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g39515 not represented in the dataset
Glyma15g39515 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g39515 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g246500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g39515
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g39515
>Glyma15g39515.1   sequence type=CDS   gene model=Glyma15g39515   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGTTAGTTGACAAATACAATAAAGTAAAATGGTCAAAAACATTGGTGCAGAAGTATCAAGAAAAGGTTGCTAGCAAATCCAAGAAAAAGTCCAACAATCTTGCTTGCATTCAAGCTAAAGATCGTACGACAGGAAGAACAGAGATTGCTTCTTGTGTCAAGGTTGTTGAGATTAGAGTGGGTGCCCATATATATCCTCAAAATCCAGTTCTTCACATTGGAAGTCCTTTCAACCTAAGCATAAAAGGTTTGAGTGATACAGTTTCTGGACAGTGGTTTACCACAAATGGAAGTGTAATATCAGTTGATACATTATCTGGGATGGCCAAAGCTATTGGGGAAGGTTGTGCACAAGATCCAGTTGAAGCTGACTCATGCAAAGAGCATTTAGTTCCACTTGCGGATATGGTGAACACATGTTACAAAGCTGCAGGGAATCATGTGTTGCCTAACTTAGCAGTCAAGAGACACGTGGTATTTAGCAAATGGGTTCTCACCAACAAGAACCATGGCTATTGCAGAATGGGAAACCAAGGGTGTTGA
Predicted protein sequences of Glyma15g39515
>Glyma15g39515.1   sequence type=predicted peptide   gene model=Glyma15g39515   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MELVDKYNKVKWSKTLVQKYQEKVASKSKKKSNNLACIQAKDRTTGRTEIASCVKVVEIRVGAHIYPQNPVLHIGSPFNLSIKGLSDTVSGQWFTTNGSVISVDTLSGMAKAIGEGCAQDPVEADSCKEHLVPLADMVNTCYKAAGNHVLPNLAVKRHVVFSKWVLTNKNHGYCRMGNQGC*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo