|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| ATCG01010 | AT | Annotation by Michelle Graham. TAIR10: NADH-Ubiquinone oxidoreductase (complex I), chain 5 protein | chrC:110398-112638 REVERSE LENGTH=746 | SoyBase | E_val: 8.00E-16 | ISS |
| GO:0015979 | GO-bp | Annotation by Michelle Graham. GO Biological Process: photosynthesis | SoyBase | N/A | ISS |
| GO:0042773 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ATP synthesis coupled electron transport | SoyBase | N/A | ISS |
| GO:0045333 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular respiration | SoyBase | N/A | ISS |
| GO:0055114 | GO-bp | Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process | SoyBase | N/A | ISS |
| GO:0009507 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: chloroplast | SoyBase | N/A | ISS |
| GO:0003954 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: NADH dehydrogenase activity | SoyBase | N/A | ISS |
| GO:0008137 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: NADH dehydrogenase (ubiquinone) activity | SoyBase | N/A | ISS |
| PF01010 | PFAM | NADH-Ubiquinone oxidoreductase (complex I), chain 5 C-terminus | JGI | ISS | |
| UniRef100_Q2PMM9 | UniRef | Annotation by Michelle Graham. Best UniRef hit: NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic n=1 Tax=Glycine max RepID=NU5C_SOYBN | SoyBase | E_val: 1.00E-44 | ISS |
| UniRef100_Q2PMM9 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: NAD(P)H-quinone oxidoreductase subunit 5, chloroplastic n=1 Tax=Glycine max RepID=NU5C_SOYBN | SoyBase | E_val: 1.00E-44 | ISS |
|
Glyma15g39454 not represented in the dataset |
Glyma15g39454 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.15g246000 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma15g39454.1 sequence type=CDS gene model=Glyma15g39454 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGATCGATATTGTCACTATCGTAACTATCATCAATATCGTCACTATGAAAAATAATGAAATGACTTCCTTTTTTATCCGGAAGATATATCCACATTGCATTAATCAAAATGTAAAAAATATAACTTGCCTTTTTTGTTATATTAATTATTTTGGCAGTAAAAAAACTGCTTGTTTATATCCAAATGAATCCGATAATACTATGCGATTTTCTATCCTTGTTTTAGTGCTCTTTACTTTATTTGTTGGGACCATAGGAATTTCTTTCAGCTATAAAGGAATAGATTTGGATATTAATTCCCTTTATAGACCTTTTACATAA
>Glyma15g39454.1 sequence type=predicted peptide gene model=Glyma15g39454 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MIDIVTIVTIINIVTMKNNEMTSFFIRKIYPHCINQNVKNITCLFCYINYFGSKKTACLYPNESDNTMRFSILVLVLFTLFVGTIGISFSYKGIDLDINSLYRPFT*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||