SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g39370

Feature Type:gene_model
Chromosome:Gm15
Start:45998566
stop:46001197
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g39370
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G53580AT Annotation by Michelle Graham. TAIR10: glyoxalase II 3 | chr1:19991542-19993250 REVERSE LENGTH=294 SoyBaseE_val: 2.00E-88ISS
GO:0009651GO-bp Annotation by Michelle Graham. GO Biological Process: response to salt stress SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0009960GO-bp Annotation by Michelle Graham. GO Biological Process: endosperm development SoyBaseN/AISS
GO:0019243GO-bp Annotation by Michelle Graham. GO Biological Process: methylglyoxal catabolic process to D-lactate SoyBaseN/AISS
GO:0048316GO-bp Annotation by Michelle Graham. GO Biological Process: seed development SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0004416GO-mf Annotation by Michelle Graham. GO Molecular Function: hydroxyacylglutathione hydrolase activity SoyBaseN/AISS
GO:0016788GO-mf Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on ester bonds SoyBaseN/AISS
GO:0050313GO-mf Annotation by Michelle Graham. GO Molecular Function: sulfur dioxygenase activity SoyBaseN/AISS
PTHR11935Panther BETA LACTAMASE DOMAIN JGI ISS
PTHR11935:SF11Panther GLYOXALASE II JGI ISS
PF00753PFAM Metallo-beta-lactamase superfamily JGI ISS
UniRef100_E4MXK9UniRef Annotation by Michelle Graham. Most informative UniRef hit: mRNA, clone: RTFL01-39-G16 n=1 Tax=Eutrema halophilum RepID=E4MXK9_THEHA SoyBaseE_val: 1.00E-86ISS
UniRef100_UPI000233BCD1UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233BCD1 related cluster n=1 Tax=unknown RepID=UPI000233BCD1 SoyBaseE_val: 7.00E-117ISS

Expression Patterns of Glyma15g39370
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g39370
ParalogEvidenceComments
Glyma13g33590 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g39370 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g245500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g39370
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g39370
>Glyma15g39370.2   sequence type=CDS   gene model=Glyma15g39370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
CTCAGATCACAAATGTGTTCTTTCTCCACCACTTCCTTTTCCTCCTCCTCCTCCAAGCTCTTGTTCCACCAGCTTTTTGAGAAGAAGTCTTCCACCTACACATACCTTCTCGCTGATGCCTCGCACCCAGAAAAACCAACACTATTGATTGACCCAGTTGATAGGACAGTAGATAGGGACTTGTCGCTTATTGAGCAACTGGGGTTGAAGATTGTGTATACGATGAATACACATGTGCATGCGGATCATGTCACTGGGACTGGCCTTATCAAGGGCAAAGTTCCTTCTGTAAAATCTGTTATTTCAAAAGCAAGTGGTGCAACGGTAGATCTTTATGTGGAGCCAGGTGATAAGGTCCATATTGGTGATCTTTTTCTAGAGGTTCGTGCAACTCCTGGTCATACCAAAGGTTGTGTTACCTATGTTACCGGAGATGCACCTGATCAACCTCAACCTAGGATGGCATTCACTGGAGATACCCTATTAATACGCGGATGTGGAAGGACAGGTTTTCAAATATATACTTGTTCAAAGTTGTTAGAACAAAGGAGAAAATGGGTGAAAGTTTGA
Predicted protein sequences of Glyma15g39370
>Glyma15g39370.2   sequence type=predicted peptide   gene model=Glyma15g39370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LRSQMCSFSTTSFSSSSSKLLFHQLFEKKSSTYTYLLADASHPEKPTLLIDPVDRTVDRDLSLIEQLGLKIVYTMNTHVHADHVTGTGLIKGKVPSVKSVISKASGATVDLYVEPGDKVHIGDLFLEVRATPGHTKGCVTYVTGDAPDQPQPRMAFTGDTLLIRGCGRTGFQIYTCSKLLEQRRKWVKV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo