|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT5G64670 | AT | Annotation by Michelle Graham. TAIR10: Ribosomal protein L18e/L15 superfamily protein | chr5:25852535-25853880 REVERSE LENGTH=281 | SoyBase | E_val: 6.00E-52 | ISS |
GO:0006354 | GO-bp | Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation | SoyBase | N/A | ISS |
GO:0006412 | GO-bp | Annotation by Michelle Graham. GO Biological Process: translation | SoyBase | N/A | ISS |
GO:0009220 | GO-bp | Annotation by Michelle Graham. GO Biological Process: pyrimidine ribonucleotide biosynthetic process | SoyBase | N/A | ISS |
GO:0042254 | GO-bp | Annotation by Michelle Graham. GO Biological Process: ribosome biogenesis | SoyBase | N/A | ISS |
GO:0005739 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion | SoyBase | N/A | ISS |
GO:0005840 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: ribosome | SoyBase | N/A | ISS |
GO:0015934 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: large ribosomal subunit | SoyBase | N/A | ISS |
GO:0003735 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome | SoyBase | N/A | ISS |
PTHR12934 | Panther | 50S RIBOSOMAL PROTEIN L15 | JGI | ISS | |
PTHR12934:SF1 | Panther | gb def: y92h12br.8.p [caenorhabditis elegans] | JGI | ISS | |
UniRef100_B9S876 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: 60S ribosomal protein L10, mitochondrial, putative n=1 Tax=Ricinus communis RepID=B9S876_RICCO | SoyBase | E_val: 2.00E-49 | ISS |
UniRef100_I1MJF2 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MJF2_SOYBN | SoyBase | E_val: 4.00E-65 | ISS |
Glyma15g39184 not represented in the dataset |
Glyma15g39184 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|---|---|---|
Glyma.15g244400 | Wm82.a2.v1 | IGC | As supplied by JGI |
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma15g39184.1 sequence type=CDS gene model=Glyma15g39184 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGGGGCGTGGTTCTGAGCAGATCAAGTGGCCAATTCATCTAGAGGTATCAAGGGTTACTGTTAGGGCTAAGGAAGCAGTTGAAGCAGCTGGTGGGTCTGTGAGAAGGGTGTATTACAATAAGTTGGGCTTGAAGGCACTGGTGAAGCCTGAGTGGTTTGAAAAGAAAGGAAGATTATTGCCTAGAGCAGCTAGACCTCCTCCTAAGCAAAAGGACAAAGTTGACAGCATTGGTCGGTTGCCTGCCCCAACGAAGCCAATTCCATTTTTAGTTGAAGCAAGCAAAGATCTTCCAGTTCAGCATCTTAGTTAA
>Glyma15g39184.1 sequence type=predicted peptide gene model=Glyma15g39184 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MGRGSEQIKWPIHLEVSRVTVRAKEAVEAAGGSVRRVYYNKLGLKALVKPEWFEKKGRLLPRAARPPPKQKDKVDSIGRLPAPTKPIPFLVEASKDLPVQHLS*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||