SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g39005): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g39005): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g39005

Feature Type:gene_model
Chromosome:Gm15
Start:45559351
stop:45560572
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g39005
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G47990AT Annotation by Michelle Graham. TAIR10: gibberellin 2-oxidase 4 | chr1:17698655-17700834 FORWARD LENGTH=321 SoyBaseE_val: 5.00E-40ISS
GO:0045487GO-bp Annotation by Michelle Graham. GO Biological Process: gibberellin catabolic process SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0005506GO-mf Annotation by Michelle Graham. GO Molecular Function: iron ion binding SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0016706GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors SoyBaseN/AISS
GO:0052634GO-mf Annotation by Michelle Graham. GO Molecular Function: C-19 gibberellin 2-beta-dioxygenase activity SoyBaseN/AISS
PTHR10209Panther FE(II)/ ASCORBATE OXIDASE SUPERFAMILY JGI ISS
PF03171PFAM 2OG-Fe(II) oxygenase superfamily JGI ISS
UniRef100_Q4W8C1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Gibberellin 2-oxidase n=1 Tax=Vigna angularis RepID=Q4W8C1_PHAAN SoyBaseE_val: 8.00E-55ISS
UniRef100_UPI000233B037UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233B037 related cluster n=1 Tax=unknown RepID=UPI000233B037 SoyBaseE_val: 6.00E-82ISS

Expression Patterns of Glyma15g39005
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g39005 not represented in the dataset
Glyma15g39005 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g39005 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g242600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g39005
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g39005
>Glyma15g39005.1   sequence type=CDS   gene model=Glyma15g39005   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATGTACGCCAGGGTTTGTGTGTGTGTGTCTGTCTTTCATTAGGGTTTGTGTGTGTGTGTACAGAGGGTGGTGAGGGTGTGTGTAGGGTTTGTGGTAATGACAGCTCTAGTGTGACTGCATACACAGAAGGTGTGAGGGAGCTAGCATGTGAGATTTTGGAGCTAATGGCAGAGGGTCTGGGGGTCCCGGATACATGGTTTTTCAGCAGGTTGATCAGGGAGGTTGACAGTGACTCAGTCCTGAGGTTCAATCACTACCCACCTATTATACTTAACAAAGACTGCTTTAAGGACAACCACAACCACACCAAGGTAATTGGCTTTGGGGAGCATTCTGACCCTCAGATTCTTACCATCCTCAGATCCAACGACGTGGCTGGCCTCCAAATCTCTCTTCAAGATGGCGTGTGGAACCCAGTTGCCCCTGACCCCTTAGCTTTCTGTGTTAATGTGGGTGATCTCTTACAGGGTAGGGAGGGGGGAGGGCTGGGTATGCGTTTGCTTGGGTTTAGGTTGGGTCTAATAACACCTCACACACACATACATTGA
Predicted protein sequences of Glyma15g39005
>Glyma15g39005.1   sequence type=predicted peptide   gene model=Glyma15g39005   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDVRQGLCVCVCLSLGFVCVCTEGGEGVCRVCGNDSSSVTAYTEGVRELACEILELMAEGLGVPDTWFFSRLIREVDSDSVLRFNHYPPIILNKDCFKDNHNHTKVIGFGEHSDPQILTILRSNDVAGLQISLQDGVWNPVAPDPLAFCVNVGDLLQGREGGGLGMRLLGFRLGLITPHTHIH*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo