SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g38980

Feature Type:gene_model
Chromosome:Gm15
Start:45488205
stop:45488597
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g38980
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G16600AT Annotation by Michelle Graham. TAIR10: rotamase CYP 3 | chr2:7200862-7201383 FORWARD LENGTH=173 SoyBaseE_val: 1.00E-52ISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0007165GO-bp Annotation by Michelle Graham. GO Biological Process: signal transduction SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005794GO-cc Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003755GO-mf Annotation by Michelle Graham. GO Molecular Function: peptidyl-prolyl cis-trans isomerase activity SoyBaseN/AISS
KOG0865 KOG Cyclophilin type peptidyl-prolyl cis-trans isomerase JGI ISS
PTHR11071Panther CYCLOPHILIN JGI ISS
PTHR11071:SF66Panther CYCLOPHILIN JGI ISS
PF00160PFAM Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD JGI ISS
UniRef100_I1MIX1UniRef Annotation by Michelle Graham. Most informative UniRef hit: Peptidyl-prolyl cis-trans isomerase (Fragment) n=2 Tax=Glycine max RepID=I1MIX1_SOYBN SoyBaseE_val: 5.00E-93ISS
UniRef100_I1MIX1UniRef Annotation by Michelle Graham. Best UniRef hit: Peptidyl-prolyl cis-trans isomerase (Fragment) n=2 Tax=Glycine max RepID=I1MIX1_SOYBN SoyBaseE_val: 5.00E-93ISS

Expression Patterns of Glyma15g38980
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g38980 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g242500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g38980
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g38980
>Glyma15g38980.1   sequence type=CDS   gene model=Glyma15g38980   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCCTCACCCTAAGGTCTTCTTCTACATGACCATTGGTGGGCAACTTGTTGGTCGCATCATGATGGAGCTCTATGCCAACATGACTCCTCGCACTGCCGGGAACTTCTACGCGCTCTACACCGACGAAAAAGGAGTAAGGCAGAGTTGTAAGCCCCTTCATTACAAGGGCTCATCCTTCCACCGCGTGATCTTGAGCTTCATGTGTCAGGGTGGCCACTTCACCTCCGAAAAAGGAAGTGGCAGCAAGTTGATCTATGGTGCCAAGTTCGCTGTGAAGAAACACACTGGTCCCAATATCCGCTCTATGGAAAACGCCAGTCCCATAACCAATAGATCACAGTTCTTTATTTGCGCAGAGAAGACAAAATGGCTTGATGAAATTGGGAGGTGA
Predicted protein sequences of Glyma15g38980
>Glyma15g38980.1   sequence type=predicted peptide   gene model=Glyma15g38980   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MPHPKVFFYMTIGGQLVGRIMMELYANMTPRTAGNFYALYTDEKGVRQSCKPLHYKGSSFHRVILSFMCQGGHFTSEKGSGSKLIYGAKFAVKKHTGPNIRSMENASPITNRSQFFICAEKTKWLDEIGR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo