SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g38780): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g38780): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g38780

Feature Type:gene_model
Chromosome:Gm15
Start:45215176
stop:45216217
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G25880AT Annotation by Michelle Graham. TAIR10: NADP-malic enzyme 3 | chr5:9024549-9028260 FORWARD LENGTH=588 SoyBaseE_val: 1.00E-45ISS
GO:0006094GO-bp Annotation by Michelle Graham. GO Biological Process: gluconeogenesis SoyBaseN/AISS
GO:0006108GO-bp Annotation by Michelle Graham. GO Biological Process: malate metabolic process SoyBaseN/AISS
GO:0006499GO-bp Annotation by Michelle Graham. GO Biological Process: N-terminal protein myristoylation SoyBaseN/AISS
GO:0007010GO-bp Annotation by Michelle Graham. GO Biological Process: cytoskeleton organization SoyBaseN/AISS
GO:0009827GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall modification SoyBaseN/AISS
GO:0009860GO-bp Annotation by Michelle Graham. GO Biological Process: pollen tube growth SoyBaseN/AISS
GO:0010498GO-bp Annotation by Michelle Graham. GO Biological Process: proteasomal protein catabolic process SoyBaseN/AISS
GO:0051260GO-bp Annotation by Michelle Graham. GO Biological Process: protein homooligomerization SoyBaseN/AISS
GO:0055114GO-bp Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0000166GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleotide binding SoyBaseN/AISS
GO:0004470GO-mf Annotation by Michelle Graham. GO Molecular Function: malic enzyme activity SoyBaseN/AISS
GO:0004473GO-mf Annotation by Michelle Graham. GO Molecular Function: malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+) activity SoyBaseN/AISS
GO:0016491GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity SoyBaseN/AISS
GO:0016616GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor SoyBaseN/AISS
GO:0016652GO-mf Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on NAD(P)H, NAD(P) as acceptor SoyBaseN/AISS
GO:0046872GO-mf Annotation by Michelle Graham. GO Molecular Function: metal ion binding SoyBaseN/AISS
GO:0051287GO-mf Annotation by Michelle Graham. GO Molecular Function: NAD binding SoyBaseN/AISS
PTHR23406Panther MALIC ENZYME-RELATED JGI ISS
PTHR23406:SF2Panther MALIC ENZYME JGI ISS
PF03949PFAM Malic enzyme, NAD binding domain JGI ISS
UniRef100_A6N1I8UniRef Annotation by Michelle Graham. Most informative UniRef hit: Malic enzyme (Fragment) n=1 Tax=Oryza sativa Indica Group RepID=A6N1I8_ORYSI SoyBaseE_val: 7.00E-54ISS
UniRef100_UPI000233F0FCUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233F0FC related cluster n=1 Tax=unknown RepID=UPI000233F0FC SoyBaseE_val: 6.00E-60ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g38780 not represented in the dataset

Glyma15g38780 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma15g38780.1   sequence type=CDS   gene model=Glyma15g38780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCTCGGACAGCTGAAGTGGCAAGTCAATTTTTGTTTATTCATATGTGTTTGTGTTTGTTCCCTTATTCTTGTGTATCACCATCAGGGAAGTGCCATTTTTGCAAGTGGGAGCCCATTTCCTCCCGTTGAGTATGAGGGCAAAGTGTTTGTGCCTGGCCAGGCCAATAATGCATACATATTTCCTGGATTTGGTCTTGGTTTAATAATGTCTGGGACCACTCGAGTGCATGATGACCTGCTTTGGGCTGCCTCTGAGGCTTTGGCTGCACAAGTGAGCCAAGAGAACTTTGATAAGGGACTCATATACCCACCATTCACCAACATAAGAAAGATTTCAGCACACATAGCTGCCAATGTTGCTTCTAAGGCTTATGAGCTT

>Glyma15g38780.1   sequence type=predicted peptide   gene model=Glyma15g38780   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLGQLKWQVNFCLFICVCVCSLILVYHHQGSAIFASGSPFPPVEYEGKVFVPGQANNAYIFPGFGLGLIMSGTTRVHDDLLWAASEALAAQVSQENFDKGLIYPPFTNIRKISAHIAANVASKAYEL







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo