SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g38501): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g38501): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g38501

Feature Type:gene_model
Chromosome:Gm15
Start:44987688
stop:44989831
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G17160AT Annotation by Michelle Graham. TAIR10: pfkB-like carbohydrate kinase family protein | chr1:5867678-5869175 FORWARD LENGTH=355 SoyBaseE_val: 2.00E-14ISS
GO:0006014GO-bp Annotation by Michelle Graham. GO Biological Process: D-ribose metabolic process SoyBaseN/AISS
GO:0019303GO-bp Annotation by Michelle Graham. GO Biological Process: D-ribose catabolic process SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0009570GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma SoyBaseN/AISS
GO:0004747GO-mf Annotation by Michelle Graham. GO Molecular Function: ribokinase activity SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0016773GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphotransferase activity, alcohol group as acceptor SoyBaseN/AISS
PF00294PFAM pfkB family carbohydrate kinase JGI ISS
UniRef100_G8A248UniRef Annotation by Michelle Graham. Most informative UniRef hit: Ribokinase n=1 Tax=Medicago truncatula RepID=G8A248_MEDTR SoyBaseE_val: 8.00E-15ISS
UniRef100_I1M2U6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M2U6_SOYBN SoyBaseE_val: 1.00E-19ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g38501 not represented in the dataset

Glyma15g38501 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma15g38501.1   sequence type=CDS   gene model=Glyma15g38501   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAGGCTGCAAGGAATGCTGGTGTGCGGGTATTGTTGAATTTTGTTGATATTTTGAGTCCTAATGAAACTGAACTTGCTCGCCTTACTGGATTGCCAACGGAGAGTTTTGAAGAGATTACACAAGCGGCTTTGAAATGCCATGAAATGCTGCTGCAGCTTGTCTTTGTGTTCAAGCGAAGGGAGCCTCTCCCTGCATGCCTGATAGGAAATCTGTTTTGGATCTTCTTAATTGTCAATGATAATACTTGCAAAAGGAGATACGAACCAGTGAAGATTTTGGATCACACATCTTGTTTCAATGACTGA

>Glyma15g38501.1   sequence type=predicted peptide   gene model=Glyma15g38501   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQAARNAGVRVLLNFVDILSPNETELARLTGLPTESFEEITQAALKCHEMLLQLVFVFKRREPLPACLIGNLFWIFLIVNDNTCKRRYEPVKILDHTSCFND*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo