Glyma15g38310 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g38310): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g38310): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g38310

Feature Type:	gene_model
Chromosome:	Gm15
Start:	44544245
stop:	44544586
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g38310

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G65720	AT	Annotation by Michelle Graham. TAIR10: nitrogen fixation S (NIFS)-like 1 \| chr5:26296733-26297710 FORWARD LENGTH=325	SoyBase	E_val: 2.00E-14	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0016226	GO-bp	Annotation by Michelle Graham. GO Biological Process: iron-sulfur cluster assembly	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0008270	GO-mf	Annotation by Michelle Graham. GO Molecular Function: zinc ion binding	SoyBase	N/A	ISS
GO:0008483	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transaminase activity	SoyBase	N/A	ISS
GO:0030170	GO-mf	Annotation by Michelle Graham. GO Molecular Function: pyridoxal phosphate binding	SoyBase	N/A	ISS
GO:0031071	GO-mf	Annotation by Michelle Graham. GO Molecular Function: cysteine desulfurase activity	SoyBase	N/A	ISS
PTHR11601	Panther	CYSTEINE DESULFURYLASE	JGI		ISS
UniRef100_B8R1J8	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Iron-sulfer cluster scaffold protein NFS1 (Fragment) n=1 Tax=Eucalyptus grandis RepID=B8R1J8_EUCGR	SoyBase	E_val: 5.00E-13	ISS
UniRef100_I1MIV4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MIV4_SOYBN	SoyBase	E_val: 8.00E-45	ISS

Expression Patterns of Glyma15g38310

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g38310 not represented in the dataset	Glyma15g38310 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g38310 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g239800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g38310

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g38310

Limit To All Plant Sequences

>Glyma15g38310.1   sequence type=CDS   gene model=Glyma15g38310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCATTGTCATCATCAAGCAATGCCTACAACGTGCCATGGGTAGAAAAGTATCGTCCCATCAAGGTCGTCGACATTGTCGTCAACGAGGACGCCATGATTTGCTCCATGGTTGAACTCACTGTTCAACAGGTGGAGAAGTTGAGGGAAATGAGTCCACTTTATGAATTTGTCAAGGAAGGTATCAACATCAAGGACATTCAATGGGCACAGCACTGA

Predicted protein sequences of Glyma15g38310

Limit To All Plant Sequences

>Glyma15g38310.1   sequence type=predicted peptide   gene model=Glyma15g38310   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSLSSSSNAYNVPWVEKYRPIKVVDIVVNEDAMICSMVELTVQQVEKLREMSPLYEFVKEGINIKDIQWAQH*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain