Glyma15g38113 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g38113): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g38113): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g38113

Feature Type:	gene_model
Chromosome:	Gm15
Start:	44192528
stop:	44193419
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g38113

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
ATCG00600	AT	Annotation by Michelle Graham. TAIR10: PETG \| chrC:65998-66111 FORWARD LENGTH=37	SoyBase	E_val: 5.00E-17	ISS
GO:0006091	GO-bp	Annotation by Michelle Graham. GO Biological Process: generation of precursor metabolites and energy	SoyBase	N/A	ISS
GO:0006354	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation	SoyBase	N/A	ISS
GO:0009767	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthetic electron transport chain	SoyBase	N/A	ISS
GO:0010207	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosystem II assembly	SoyBase	N/A	ISS
GO:0015979	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009512	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytochrome b6f complex	SoyBase	N/A	ISS
GO:0003674	GO-mf	Annotation by Michelle Graham. GO Molecular Function: molecular function	SoyBase	N/A	ISS
PF02529	PFAM	Cytochrome B6-F complex subunit 5	JGI		ISS
UniRef100_D3J8I3	UniRef	Annotation by Michelle Graham. Best UniRef hit: Cytochrome b6/f complex subunit V n=2 Tax=Vigna RepID=D3J8I3_VIGRA	SoyBase	E_val: 2.00E-15	ISS
UniRef100_D3J8I3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Cytochrome b6/f complex subunit V n=2 Tax=Vigna RepID=D3J8I3_VIGRA	SoyBase	E_val: 2.00E-15	ISS

Expression Patterns of Glyma15g38113

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g38113 not represented in the dataset	Glyma15g38113 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g38113 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma15g38113

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g38113

Limit To All Plant Sequences

>Glyma15g38113.1   sequence type=CDS   gene model=Glyma15g38113   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATTGAAGTTTTTCTATTTGGAATCAGGTTAGGTTTAATTCCCATTACTTTGGCTGGATTATTTGTAACTGCATATTTACAATACCGACGAGGTGATCAGTTGAATCTTTGA

Predicted protein sequences of Glyma15g38113

Limit To All Plant Sequences

>Glyma15g38113.1   sequence type=predicted peptide   gene model=Glyma15g38113   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIEVFLFGIRLGLIPITLAGLFVTAYLQYRRGDQLNL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain