SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g37883

Feature Type:gene_model
Chromosome:Gm15
Start:43888634
stop:43890617
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g37883
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G54470AT Annotation by Michelle Graham. TAIR10: uridine 5'-monophosphate synthase / UMP synthase (PYRE-F) (UMPS) | chr3:20168285-20170245 REVERSE LENGTH=476 SoyBaseE_val: 3.00E-39ISS
GO:0006207GO-bp Annotation by Michelle Graham. GO Biological Process: 'de novo' pyrimidine nucleobase biosynthetic process SoyBaseN/AISS
GO:0006221GO-bp Annotation by Michelle Graham. GO Biological Process: pyrimidine nucleotide biosynthetic process SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0009116GO-bp Annotation by Michelle Graham. GO Biological Process: nucleoside metabolic process SoyBaseN/AISS
GO:0009220GO-bp Annotation by Michelle Graham. GO Biological Process: pyrimidine ribonucleotide biosynthetic process SoyBaseN/AISS
GO:0016036GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to phosphate starvation SoyBaseN/AISS
GO:0044205GO-bp Annotation by Michelle Graham. GO Biological Process: 'de novo' UMP biosynthetic process SoyBaseN/AISS
GO:0046686GO-bp Annotation by Michelle Graham. GO Biological Process: response to cadmium ion SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004588GO-mf Annotation by Michelle Graham. GO Molecular Function: orotate phosphoribosyltransferase activity SoyBaseN/AISS
GO:0004590GO-mf Annotation by Michelle Graham. GO Molecular Function: orotidine-5'-phosphate decarboxylase activity SoyBaseN/AISS
PTHR19278Panther OROTIDINE 5-PHOSPHATE DECARBOXYLASE-RELATED JGI ISS
PTHR19278:SF21Panther SUBFAMILY NOT NAMED JGI ISS
UniRef100_I1M0T9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1M0T9_SOYBN SoyBaseE_val: 3.00E-51ISS
UniRef100_Q1RU71UniRef Annotation by Michelle Graham. Most informative UniRef hit: Phosphoribosyltransferase; Orotidine 5-phosphate decarboxylase n=1 Tax=Medicago truncatula RepID=Q1RU71_MEDTR SoyBaseE_val: 1.00E-46ISS

Expression Patterns of Glyma15g37883
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g37883 not represented in the dataset
Glyma15g37883 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g37883
ParalogEvidenceComments
Glyma13g26870 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g37883 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g237000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g37883
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Transcripts of Glyma15g37883
>Glyma15g37883.2   sequence type=transcript   gene model=Glyma15g37883   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTCTCGTAGCATCAACATCTCCCATGAAAGTGCAAACCAAAACCAAATGCAACACCACACCCTTCATTTTCTCTCACTGTGAACTACACACACCACTCTGTGTCCTCTTCTAATGTTGCATACTGAATTACACAAGTTATGCCTAAGGCCTAAAATAAGCCTTGAAGCACACTGGGAAATGCACATCAATGGAATCTCTAGTTCTTCAACTCCATGAAATCTCAGCTATCAAATTTGGCAATTTCAAGCTCAAGTCTGGCATCTCCTCTCCAATCTACATAGATCTTCGCCTTGCTATATCTTATCCTTCTGTCCTCCGGAATATTTCTCAAACCCTTATTTCTTCTGTCTCTTCCACTTCATTTGACCTTGCCTGTGGTGTCCCCTACACTGCTCTGCCCATTGCCACTTGTGTCTCTGTTACTCAGAACATCCCCATGGTCATGCGCGGCAAGGATGCATGATGTTATGGTGGAGCATCAGTGAATATATTCATGAAGGTAATTGAATGCTAGGTTTGACAGTAGGACAACATGCATGTTTCATTTTATAGCAGTGAAATTATATGAATGTGGGAGAGTATACCCTAGCATACCAAGTGGTTTGGCAATTGAAATGGCTTATTTTGTTTTTGGTTTTAAATGTACCCTTTTACATCAATATGGATAATAGAATATGTATAAACTTTCTTTGGTGGACTTTAGCTTTCCCTGTGCAAG

>Glyma15g37883.3   sequence type=transcript   gene model=Glyma15g37883   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTCTCGTAGCATCAACATCTCCCATGAAAGTGCAAACCAAAACCAAATGCAACACCACACCCTTCATTTTCTCTCACTGTGAACTACACACACCACTCTGTGTCCTCTTCTAAGGTGGGATTTAAAATTTGTGGACTTGTGCTTGCCTATGATTTCATCTGAAACCAATGGGAGTTGGGTCTAACAGAAGGGCTAGTCCCTCACAGCATGGTGAACCAAGGTCCAAATCGCTACTACGAGAGATGTTGCATACTGAATTACACAAGTTATGCCTAAGGCCTAAAATAAGCCTTGAAGCACACTGGGAAATGCACATCAATGGAATCTCTAGTTCTTCAACTCCATGAAATCTCAGCTATCAAATTTGGCAATTTCAAGCTCAAGTCTGGCATCTCCTCTCCAATCTACATAGATCTTCGCCTTGCTATATCTTATCCTTCTGTCCTCCGGAATATTTCTCAAACCCTTATTTCTTCTGTCTCTTCCACTTCATTTGACCTTGCCTGTGGTGTCCCCTACACTGCTCTGCCCATTGCCACTTGTGTCTCTGTTACTCAGAACATCCCCATGGTCATGCGCGGCAAGGATGCATGATGTTATGGTGGAGCATCAGTGAATATATTCATGAAGGTAATTGAATGCTAGGTTTGACAGTAGGACAACATGCATGTTTCATTTTATAGCAGTGAAATTATATGAATGTGGGAGAGTATACCCTAGCATACCAAGTGGTTTGGCAATTGAAATGGCTTATTTTGTTTTTGGTTTTAAATGTACCCTTTTACATCAATATGGATAATAGAATATGTATAAACTTTCTTTGGTGGACTTTAGCTTTCCCTGTGCAAG
Coding sequences of Glyma15g37883
>Glyma15g37883.1   sequence type=CDS   gene model=Glyma15g37883   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAATCTCTAGTTCTTCAACTCCATGAAATCTCAGCTATCAAATTTGGCAATTTCAAGCTCAAGTCTGGCATCTCCTCTCCAATCTACATAGATCTTCGCCTTGCTATATCTTATCCTTCTGTCCTCCGGAATATTTCTCAAACCCTTATTTCTTCTGTCTCTTCCACTTCATTTGACCTTGCCTGTGGTGTCCCCTACACTGCTCTGCCCATTGCCACTTGTGTCTCTGTTACTCAGAACATCCCCATGGTCATGCGCGGCAAGGATGCATGA

>Glyma15g37883.2   sequence type=CDS   gene model=Glyma15g37883   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAATCTCTAGTTCTTCAACTCCATGAAATCTCAGCTATCAAATTTGGCAATTTCAAGCTCAAGTCTGGCATCTCCTCTCCAATCTACATAGATCTTCGCCTTGCTATATCTTATCCTTCTGTCCTCCGGAATATTTCTCAAACCCTTATTTCTTCTGTCTCTTCCACTTCATTTGACCTTGCCTGTGGTGTCCCCTACACTGCTCTGCCCATTGCCACTTGTGTCTCTGTTACTCAGAACATCCCCATGGTCATGCGCGGCAAGGATGCATGA

>Glyma15g37883.3   sequence type=CDS   gene model=Glyma15g37883   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAATCTCTAGTTCTTCAACTCCATGAAATCTCAGCTATCAAATTTGGCAATTTCAAGCTCAAGTCTGGCATCTCCTCTCCAATCTACATAGATCTTCGCCTTGCTATATCTTATCCTTCTGTCCTCCGGAATATTTCTCAAACCCTTATTTCTTCTGTCTCTTCCACTTCATTTGACCTTGCCTGTGGTGTCCCCTACACTGCTCTGCCCATTGCCACTTGTGTCTCTGTTACTCAGAACATCCCCATGGTCATGCGCGGCAAGGATGCATGA
Predicted protein sequences of Glyma15g37883
>Glyma15g37883.1   sequence type=predicted peptide   gene model=Glyma15g37883   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MESLVLQLHEISAIKFGNFKLKSGISSPIYIDLRLAISYPSVLRNISQTLISSVSSTSFDLACGVPYTALPIATCVSVTQNIPMVMRGKDA*

>Glyma15g37883.2   sequence type=predicted peptide   gene model=Glyma15g37883   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MESLVLQLHEISAIKFGNFKLKSGISSPIYIDLRLAISYPSVLRNISQTLISSVSSTSFDLACGVPYTALPIATCVSVTQNIPMVMRGKDA*

>Glyma15g37883.3   sequence type=predicted peptide   gene model=Glyma15g37883   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MESLVLQLHEISAIKFGNFKLKSGISSPIYIDLRLAISYPSVLRNISQTLISSVSSTSFDLACGVPYTALPIATCVSVTQNIPMVMRGKDA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo