SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g37830): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g37830): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g37830

Feature Type:gene_model
Chromosome:Gm15
Start:43803323
stop:43819936
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g37830
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G13480AT Annotation by Michelle Graham. TAIR10: Transducin/WD40 repeat-like superfamily protein | chr5:4326638-4331557 REVERSE LENGTH=647 SoyBaseE_val: 0ISS
GO:0000398GO-bp Annotation by Michelle Graham. GO Biological Process: mRNA splicing, via spliceosome SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0006396GO-bp Annotation by Michelle Graham. GO Biological Process: RNA processing SoyBaseN/AISS
GO:0006397GO-bp Annotation by Michelle Graham. GO Biological Process: mRNA processing SoyBaseN/AISS
GO:0006406GO-bp Annotation by Michelle Graham. GO Biological Process: mRNA export from nucleus SoyBaseN/AISS
GO:0006470GO-bp Annotation by Michelle Graham. GO Biological Process: protein dephosphorylation SoyBaseN/AISS
GO:0007062GO-bp Annotation by Michelle Graham. GO Biological Process: sister chromatid cohesion SoyBaseN/AISS
GO:0009640GO-bp Annotation by Michelle Graham. GO Biological Process: photomorphogenesis SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0009845GO-bp Annotation by Michelle Graham. GO Biological Process: seed germination SoyBaseN/AISS
GO:0009880GO-bp Annotation by Michelle Graham. GO Biological Process: embryonic pattern specification SoyBaseN/AISS
GO:0009909GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of flower development SoyBaseN/AISS
GO:0009933GO-bp Annotation by Michelle Graham. GO Biological Process: meristem structural organization SoyBaseN/AISS
GO:0010072GO-bp Annotation by Michelle Graham. GO Biological Process: primary shoot apical meristem specification SoyBaseN/AISS
GO:0010074GO-bp Annotation by Michelle Graham. GO Biological Process: maintenance of meristem identity SoyBaseN/AISS
GO:0010162GO-bp Annotation by Michelle Graham. GO Biological Process: seed dormancy process SoyBaseN/AISS
GO:0010182GO-bp Annotation by Michelle Graham. GO Biological Process: sugar mediated signaling pathway SoyBaseN/AISS
GO:0010228GO-bp Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem SoyBaseN/AISS
GO:0010431GO-bp Annotation by Michelle Graham. GO Biological Process: seed maturation SoyBaseN/AISS
GO:0010564GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle process SoyBaseN/AISS
GO:0016567GO-bp Annotation by Michelle Graham. GO Biological Process: protein ubiquitination SoyBaseN/AISS
GO:0016570GO-bp Annotation by Michelle Graham. GO Biological Process: histone modification SoyBaseN/AISS
GO:0019915GO-bp Annotation by Michelle Graham. GO Biological Process: lipid storage SoyBaseN/AISS
GO:0022402GO-bp Annotation by Michelle Graham. GO Biological Process: cell cycle process SoyBaseN/AISS
GO:0030422GO-bp Annotation by Michelle Graham. GO Biological Process: production of siRNA involved in RNA interference SoyBaseN/AISS
GO:0035196GO-bp Annotation by Michelle Graham. GO Biological Process: production of miRNAs involved in gene silencing by miRNA SoyBaseN/AISS
GO:0043687GO-bp Annotation by Michelle Graham. GO Biological Process: post-translational protein modification SoyBaseN/AISS
GO:0045595GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell differentiation SoyBaseN/AISS
GO:0045893GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0048366GO-bp Annotation by Michelle Graham. GO Biological Process: leaf development SoyBaseN/AISS
GO:0048449GO-bp Annotation by Michelle Graham. GO Biological Process: floral organ formation SoyBaseN/AISS
GO:0048825GO-bp Annotation by Michelle Graham. GO Biological Process: cotyledon development SoyBaseN/AISS
GO:0050826GO-bp Annotation by Michelle Graham. GO Biological Process: response to freezing SoyBaseN/AISS
GO:0051301GO-bp Annotation by Michelle Graham. GO Biological Process: cell division SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0080008GO-cc Annotation by Michelle Graham. GO Cellular Compartment: CUL4-RING ubiquitin ligase complex SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
KOG0284 KOG Polyadenylation factor I complex, subunit PFS2 JGI ISS
PTHR22836Panther WD40 REPEAT PROTEIN JGI ISS
PF00400PFAM WD domain, G-beta repeat JGI ISS
UniRef100_A4Q377UniRef Annotation by Michelle Graham. Most informative UniRef hit: WD40-like n=1 Tax=Medicago truncatula RepID=A4Q377_MEDTR SoyBaseE_val: 0ISS
UniRef100_UPI000233B8C6UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233B8C6 related cluster n=1 Tax=unknown RepID=UPI000233B8C6 SoyBaseE_val: 0ISS

Expression Patterns of Glyma15g37830
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g37830 not represented in the dataset
Glyma15g37830 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g37830
ParalogEvidenceComments
Glyma13g26820 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g37830 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g236500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g37830
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g37830
>Glyma15g37830.2   sequence type=CDS   gene model=Glyma15g37830   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCATGTTTCTTGGCATGCAAACCTTCCAATGAATCCCAACCTGAAGCTCAATCTTCATGATAGAGACTTACTACCTGATCCCTCAGTGTATAAAAGTAAAACGCCGTCGTTCCTTGTTCCGTTCCCTTCTTCTCTCGGTTTCCCGCTCCGCATACTCTGCTCTTCGTTCTTCCTCATTCCCAACCACATTTTGGGGTTTAGGGTTTTTCTCTCTCCTCTGCAATATCCAATTTCTCCCTCACTCTCTCTCCACAATCCAGTGACAATGATGTACAATGATCAGCAGCATCAGCACCAGCAGCACCAGTACCAGCAACAACAGCAGCAGCAGCAGCAGCCTTTCCACCAGCCGCCGGGTCCGGAGTTCCACCGCGGACCGCCGCCGCCGTCGCATCCGCCGCCGATGATGCGGCAAGGCTCCGCCTCGTCGACGAACCTCGCCCCCGAGTTTCACCATCCCGGCCCCGGAGGGCCCCCGCCTCCTCATTACGATGCTCACAGTGATAGCCATGGTGCAAAAAGAATACGAAAGCTTACTCAAAGGAAAGCTGTTGATTATACAAGCACAGTTGTGCGTTATATGCAGATTCGTATGTCGCAGCGGGATTCAAGGGATAGGACAGTACTGCAACCCACCCCGGCAGCAGCAATTGATATGTTGCCAGCAGTTGGCTATCCAGACAATCCATCCACAAGCTTTGCTGCTAAATTTGTTCATACATCTCTAAATAAAAATCGTTGCCCCATTAATCGCGTTCTTTGGACTCCAACAGGCCGGCGACTTATTACTGGTTCACAGACTGGGGAATTTACTCTTTGGAATGGACAATCTTTTAATTTTGAAATGATTCTTCAGGCGCATGATCAAGCAATCAGATCCATGGTCTGGAGTCACAATGACAATTGGATGGTCTCTGGTGATGATGGAGGCGCAATAAAGTATTGGCAGAACAACATGAACAATGTTAAAGCCAACAAATCTGCTCATAAAGAATCAGTCCGTGATTTAAGTTTCTGTAGGACAGATTTGAAGTTCTGTTCATGCTCTGATGATACCACAGTTAAAGTTTGGGATTTTGCACGCTGTCAAGAAGAGTGTTCATTATCTGGCCATGGTTGGGATGTGAAGAGTGTTGACTGGCATCCTACAAAATCTCTATTAGTATCAGGTGGGAAGGACAATCTAGTGAAACTTTGGGATGCTAAAACAGGGAGAGAGCTTTGTTCATTTCATGGCCACAAAAACACTGTGCTGTGTGTAAAATGGAATCAAAATGGCAACTGGGTGTTAACGGCTTCAAAGGATCAAATAATAAAGCTTTATGACATAAGAGCAATGAAGGAACTTGAATCGTTCCGTGGGCATCGCAAGGATGTTACTACTTTGGCATGGCATCCGTTCCATGAAGAGTACTTTGTCAGTGGGAGTTATGATGGTTCCATCTTCCATTGGCTTGTTGGGCATGAAACTCCACAAATTGAAATTTCCAATGCTCATGATAATAATGTGTGGGATCTTGCATGGCATCCTATTGGATACCTTCTGTGCAGTGGCAGCAGTGATCATACAACAAAGTTTTGGTGCAGAAATAGGCCAGGAGACCCTGCCCGTGATAGATTTAACACTGGCATGCCAGGATATGCTGACCAAAATCCTGTTGTTGGTCGGATGGGTGGTAATTTTACAATAGCTGAAGGCCCAACAACTCCAGGACCATTTGCCCCTGGGTTGACTCGAAATGAGGGTACCATTCCAGGTGTTGGAGTTGCAATGCCCTTGTCTATTCCTTCTCTTGACATGCCTCAAGGGGAGCAGAAGCAACCCCATCCTGTTTCAATGGGTGCTCCTCCTCTTCCCCCCGGTCCACATCCCTCCCTTCTTAATGCCAACCAACAGCAACCATACCAACAGAATCCTCAGCAGATCCCACAACATCAACACCAGGCTCTACCACAACAGATGGGTCCTTTGCCTATGCCTCCAAATATGCAACAACTACAGCACCCTTCCCATTCTCCCTTCCCTAATATGCCTCGCCCTCCACCCCAAATGCCTATTGGCATGCCAGGATCTATACCAGGGATTTCATCAGTGCCTACATCACATCCAATGCCAATGCCAGGTCCAATGGGAATGCAAGGGGCGATGAATCAGATGGGTACTCCAATGCCACAAGGTCCTTATGTAGGCATGAATCAAATGCATTCAGGGTCCTTGCCTACAAGTGGAGGGCCACCTCTTGGTGGTTTTCCAGGCAACTTGCCAAATATGCAAGGGCCATCAAATGCCAATTATCCTCAAGGTGCTTCATTTAACAGACCTCAAGGTGGCCAAATGCCTCTGATGCAAGGGTATAGTCCTTACCAGGTAAGATAG
Predicted protein sequences of Glyma15g37830
>Glyma15g37830.2   sequence type=predicted peptide   gene model=Glyma15g37830   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MHVSWHANLPMNPNLKLNLHDRDLLPDPSVYKSKTPSFLVPFPSSLGFPLRILCSSFFLIPNHILGFRVFLSPLQYPISPSLSLHNPVTMMYNDQQHQHQQHQYQQQQQQQQQPFHQPPGPEFHRGPPPPSHPPPMMRQGSASSTNLAPEFHHPGPGGPPPPHYDAHSDSHGAKRIRKLTQRKAVDYTSTVVRYMQIRMSQRDSRDRTVLQPTPAAAIDMLPAVGYPDNPSTSFAAKFVHTSLNKNRCPINRVLWTPTGRRLITGSQTGEFTLWNGQSFNFEMILQAHDQAIRSMVWSHNDNWMVSGDDGGAIKYWQNNMNNVKANKSAHKESVRDLSFCRTDLKFCSCSDDTTVKVWDFARCQEECSLSGHGWDVKSVDWHPTKSLLVSGGKDNLVKLWDAKTGRELCSFHGHKNTVLCVKWNQNGNWVLTASKDQIIKLYDIRAMKELESFRGHRKDVTTLAWHPFHEEYFVSGSYDGSIFHWLVGHETPQIEISNAHDNNVWDLAWHPIGYLLCSGSSDHTTKFWCRNRPGDPARDRFNTGMPGYADQNPVVGRMGGNFTIAEGPTTPGPFAPGLTRNEGTIPGVGVAMPLSIPSLDMPQGEQKQPHPVSMGAPPLPPGPHPSLLNANQQQPYQQNPQQIPQHQHQALPQQMGPLPMPPNMQQLQHPSHSPFPNMPRPPPQMPIGMPGSIPGISSVPTSHPMPMPGPMGMQGAMNQMGTPMPQGPYVGMNQMHSGSLPTSGGPPLGGFPGNLPNMQGPSNANYPQGASFNRPQGGQMPLMQGYSPYQVR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo