SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g37770): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g37770): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g37770

Feature Type:gene_model
Chromosome:Gm15
Start:43727098
stop:43729372
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G41310AT Annotation by Michelle Graham. TAIR10: response regulator 3 | chr2:17222280-17223536 FORWARD LENGTH=225 SoyBaseE_val: 2.00E-72ISS
GO:0000160GO-bp Annotation by Michelle Graham. GO Biological Process: phosphorelay signal transduction system SoyBaseN/AISS
GO:0006355GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent SoyBaseN/AISS
GO:0007623GO-bp Annotation by Michelle Graham. GO Biological Process: circadian rhythm SoyBaseN/AISS
GO:0009736GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinin mediated signaling pathway SoyBaseN/AISS
GO:0010029GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of seed germination SoyBaseN/AISS
GO:0031537GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of anthocyanin metabolic process SoyBaseN/AISS
GO:0048831GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of shoot development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0000156GO-mf Annotation by Michelle Graham. GO Molecular Function: phosphorelay response regulator activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PTHR26402Panther RESPONSE REGULATOR OF TWO-COMPONENT SYSTEM JGI ISS
PTHR26402:SF52Panther JGI ISS
PF00072PFAM Response regulator receiver domain JGI ISS
UniRef100_I1MIR9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MIR9_SOYBN SoyBaseE_val: 1.00E-128ISS
UniRef100_Q1RU46UniRef Annotation by Michelle Graham. Most informative UniRef hit: Response regulator receiver n=1 Tax=Medicago truncatula RepID=Q1RU46_MEDTR SoyBaseE_val: 5.00E-102ISS

LocusGene SymbolProtein Name
RR06 Root specific, Response Regulator Type-A

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g37770 not represented in the dataset

Glyma15g37770 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

ParalogEvidenceComments
Glyma13g26770 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g236200 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma15g37770.1   sequence type=CDS   gene model=Glyma15g37770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTATGACTGTAGAGGCTCAGTTCCATGTTTTGGCTGTTGATGACAGTATTATTGACCGAATGCTGATTGAGAGGCTCCTAAAAACCTCTTCCTTTCATGTTACTACAGTGGACTCTGCCACTAAGGCCTTAAAATTTCTTGGTTTGGTTGAAGATGAGTTGAGGACTTTTGACACCACTGTTGCATCAGAAATTCATCAGGATGTAGATATAAACCTGATTATAACAGATTACTGCATGCCAGGAATGACTGGCTATGATCTGCTGAGAAAAATCAAGGAATCTAAATCTCTTAAAAACATACCAGTTGTGATTATGTCCTCAGAGAATGTACCATCAAGGATCAACAGATGCTTGGAAGAGGGAGCAGAAGAGTTCTTTCTGAAACCAGTTCAACAGGCAGATGTGAACAAGCTGAAGCCACATTTGATGAAATCAAGAGCAAAGGAAGAGCAAGACCAACCCTTCAATAACAAAAGGAAGGACATGGAAGAAATCCATTCCCCAAATAAAACCAGAATAAAATGTAGCAGTTAA

>Glyma15g37770.1   sequence type=predicted peptide   gene model=Glyma15g37770   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAMTVEAQFHVLAVDDSIIDRMLIERLLKTSSFHVTTVDSATKALKFLGLVEDELRTFDTTVASEIHQDVDINLIITDYCMPGMTGYDLLRKIKESKSLKNIPVVIMSSENVPSRINRCLEEGAEEFFLKPVQQADVNKLKPHLMKSRAKEEQDQPFNNKRKDMEEIHSPNKTRIKCSS*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo