SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g37640

Feature Type:gene_model
Chromosome:Gm15
Start:43545439
stop:43548370
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g37640
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G07340AT Annotation by Michelle Graham. TAIR10: PREFOLDIN 1 | chr2:3045644-3046606 FORWARD LENGTH=128 SoyBaseE_val: 7.00E-60ISS
GO:0006457GO-bp Annotation by Michelle Graham. GO Biological Process: protein folding SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0016272GO-cc Annotation by Michelle Graham. GO Cellular Compartment: prefoldin complex SoyBaseN/AISS
GO:0051082GO-mf Annotation by Michelle Graham. GO Molecular Function: unfolded protein binding SoyBaseN/AISS
KOG3501 KOG Molecular chaperone Prefoldin, subunit 1 JGI ISS
PTHR20903Panther PREFOLDIN SUBUNIT 1-RELATED JGI ISS
PF01920PFAM Prefoldin subunit JGI ISS
UniRef100_B7FMP0UniRef Annotation by Michelle Graham. Most informative UniRef hit: Prefoldin subunit n=2 Tax=Medicago truncatula RepID=B7FMP0_MEDTR SoyBaseE_val: 5.00E-73ISS
UniRef100_C6SW11UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=C6SW11_SOYBN SoyBaseE_val: 1.00E-86ISS

Expression Patterns of Glyma15g37640
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g37640 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g235500 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g37640
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g37640
>Glyma15g37640.1   sequence type=CDS   gene model=Glyma15g37640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCAGACGAAGCTAACAGAACTGCTTTCCTTGAAATTCAAAGTCGCATGATCGATACTACTGGAAAAATAAAACAGGTGCAAACCCAGATGCGTTCCAAAGAAGCAGAAAAGAAGCGTGCTTTTCTGACCATGGAGGAGCTGAAGCAAGTTCCTGATGATACTAATGTTTACAAATCCATTGGGAGAATGTTTGTATTGGAGACCAAGGCAACATTAATGAATGAGCAGGAGAACAAGTTTAAGGATGGTGAAGCTTCAATTACAGCTTTACAGAGCTCAAAAGAATACTTGGAAAAACAGATGGCAGAGGTGGAAACCAATTTGAGAGAACTGTTACAACAAGATCCTGGTCTTGCTAGGCAAATAATGTCAATGAATGTAGTGTAA
Predicted protein sequences of Glyma15g37640
>Glyma15g37640.1   sequence type=predicted peptide   gene model=Glyma15g37640   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MADEANRTAFLEIQSRMIDTTGKIKQVQTQMRSKEAEKKRAFLTMEELKQVPDDTNVYKSIGRMFVLETKATLMNEQENKFKDGEASITALQSSKEYLEKQMAEVETNLRELLQQDPGLARQIMSMNVV*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo