SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g37580): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g37580): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g37580

Feature Type:gene_model
Chromosome:Gm15
Start:43462306
stop:43464178
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G40730AT Annotation by Michelle Graham. TAIR10: Protein kinase family protein with ARM repeat domain | chr2:16990083-16996072 REVERSE LENGTH=798 SoyBaseE_val: 2.00E-55ISS
GO:0000910GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinesis SoyBaseN/AISS
GO:0006409GO-bp Annotation by Michelle Graham. GO Biological Process: tRNA export from nucleus SoyBaseN/AISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0007017GO-bp Annotation by Michelle Graham. GO Biological Process: microtubule-based process SoyBaseN/AISS
GO:0000049GO-mf Annotation by Michelle Graham. GO Molecular Function: tRNA binding SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
PTHR12984Panther SCY1-RELATED S/T PROTEIN KINASE-LIKE JGI ISS
PTHR12984:SF3Panther PACE-1-RELATED JGI ISS
UniRef100_G8A2K1UniRef Annotation by Michelle Graham. Most informative UniRef hit: N-terminal kinase-like protein (Fragment) n=1 Tax=Medicago truncatula RepID=G8A2K1_MEDTR SoyBaseE_val: 3.00E-61ISS
UniRef100_UPI00023388F6UniRef Annotation by Michelle Graham. Best UniRef hit: UPI00023388F6 related cluster n=1 Tax=unknown RepID=UPI00023388F6 SoyBaseE_val: 4.00E-71ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g37580 not represented in the dataset

Glyma15g37580 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma15g37580.1   sequence type=CDS   gene model=Glyma15g37580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTTCTGTTCATCATACCTTCAATGAGATGCATAGTTTACATTACATTGATATTTGTAATATTAAATGAGCTTGTTTCCTGTGCTGTTCCTTTTCTTTATTTTTTTCCTCCTCCTTTCCCAAATTTTATAGCATATTTATTTGGTGAAACTTCACTGCACAATTTTGTCTCAAAGGACAATGTCAGGGTCATTATTGAAGTATTTGTCAAAGTTGCAGTACATAGATCCTTTTTTGAAGCATATGTTGTTGATGAAGAGCCAGCAATTAGAACAAATACTACCATATTATTAGGCAATATTGGAAGTTACTTAAATGAAGGAAAAAGAGTTTTGATTAATGCATTTACAGTCCGCGCATTACGTGATACTTTTCCACCTGCTAGAGGAGCAGGAATTATGGCTTTATGCGCCACCAGTTCCTACTATGACATCACTGAAGTTGCAACTCGGATTCTTCCTAATGTTGTTGTGCTCACAATTGATCCTAACAGAACTAAGGCATTTCAAGCTATTGATCAACTTTTGCAGATAGCAAAGCAACATTATGAAAAGACAAATGCAACAGATACTAGTTGTGGTGTGGGAAGTTCATTTGTTCCAGGAAATGCTAGTTTGCTT

>Glyma15g37580.1   sequence type=predicted peptide   gene model=Glyma15g37580   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
FLFIIPSMRCIVYITLIFVILNELVSCAVPFLYFFPPPFPNFIAYLFGETSLHNFVSKDNVRVIIEVFVKVAVHRSFFEAYVVDEEPAIRTNTTILLGNIGSYLNEGKRVLINAFTVRALRDTFPPARGAGIMALCATSSYYDITEVATRILPNVVVLTIDPNRTKAFQAIDQLLQIAKQHYEKTNATDTSCGVGSSFVPGNASLL







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo