Glyma15g37451 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g37451

Feature Type:	gene_model
Chromosome:	Gm15
Start:	43274170
stop:	43277199
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g37451

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G54390	AT	Annotation by Michelle Graham. TAIR10: sequence-specific DNA binding transcription factors \| chr3:20137912-20138863 REVERSE LENGTH=296	SoyBase	E_val: 1.00E-104	ISS
GO:0006355	GO-bp	Annotation by Michelle Graham. GO Biological Process: regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0003700	GO-mf	Annotation by Michelle Graham. GO Molecular Function: sequence-specific DNA binding transcription factor activity	SoyBase	N/A	ISS
KOG4282	KOG	Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain	JGI		ISS
UniRef100_D7LUT4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Transcription factor n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7LUT4_ARALL	SoyBase	E_val: 6.00E-101	ISS
UniRef100_I1M0R0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=2 Tax=Glycine max RepID=I1M0R0_SOYBN	SoyBase	E_val: 0	ISS

Expression Patterns of Glyma15g37451

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g37451 not represented in the dataset	Glyma15g37451 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g37451

Paralog	Evidence	Comments
Glyma13g26550	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g37451 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g234100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g37451

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g37451

Limit To All Plant Sequences

>Glyma15g37451.1   sequence type=CDS   gene model=Glyma15g37451   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGAGTTGTTGAACAAGAAATGGAAGAGGAAGAGAAAGAAAAACATACAAACAACCATAACCACCCTTCTTCTCTCCACCCAATTAAGGAAGAGTGTGTTAGTGTGAGAAAACCCTTTAGTGGTGATAGAGTGAAGAGAGATGAATGGAGTGAAGGGGCAGTGTCAACCCTCCTTGAGGCTTATGAGGCCAAATGGGTGCTAAGAAACAGAGCCAAACTCAAGGGCCATGATTGGGAGGATGTGGCACGGCACGTGTCGGCACGTGCCAACTGCACCAAATCACCAAAGACTTCAACGCAGTGTAAGAACAAGGTTGAGTCCATGAAGAAGAGATACAGATCAGAATCAGCAGCAACAGCAGATCATGCATCATCATCATGGCCTCTTTATTCACGGCTTGATCTTCTTCTTAGGGGAACTGGACCCGTGTTGTCGTCGCCGCCGCCGCCACCGGCGATGATGCCGGCGGCGATGCCGGTTCTGTCTCCGGTGGAGCCGTCGCAACCGCCGCAGCTGTCGCCGCCTCCGGCGGCTCCTTCAGGGCCACTTGCTAATGCACAAAACTCGCATGGATCCAACGGAATTGATGAGAAGCTTGCTAAGGAAGATGGGTTAGGAACTAAGTCATCTGATCAAGTATCTAGCAAGAATCCATTGGACACAGATAGCAGCACGCCAGCACTTTATAGCAAGAAGGACGGGTTAAGATGCAACAAGAGGAAGAAGAAAACAATTGACAACACAGGGCGAAGAAGGAAAGAGTGTGTGGAGATAGCAGAAAGCTTAAGATGGCTTACAGAAGCTATGATAAGGTCTGAGCAAGCAAGAATGGACACAATGAAGGAGATAGAGAGGATGAGAGTTGAAGCTGAGGCCAAAAGAGGGGAAATGGACCTTAAGAGAACTGAAATAATTGCCAATACACAGTTAGAGATTGCTAGGATCTTTGCAAGTGTCAACAATAAAGGTGTTGATTCATCTCTAAGAATTGGAAGAAGTTAA

Predicted protein sequences of Glyma15g37451

Limit To All Plant Sequences

>Glyma15g37451.1   sequence type=predicted peptide   gene model=Glyma15g37451   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGVVEQEMEEEEKEKHTNNHNHPSSLHPIKEECVSVRKPFSGDRVKRDEWSEGAVSTLLEAYEAKWVLRNRAKLKGHDWEDVARHVSARANCTKSPKTSTQCKNKVESMKKRYRSESAATADHASSSWPLYSRLDLLLRGTGPVLSSPPPPPAMMPAAMPVLSPVEPSQPPQLSPPPAAPSGPLANAQNSHGSNGIDEKLAKEDGLGTKSSDQVSSKNPLDTDSSTPALYSKKDGLRCNKRKKKTIDNTGRRRKECVEIAESLRWLTEAMIRSEQARMDTMKEIERMRVEAEAKRGEMDLKRTEIIANTQLEIARIFASVNNKGVDSSLRIGRS*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain