SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g37370

Feature Type:gene_model
Chromosome:Gm15
Start:43139087
stop:43139694
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g37370
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G55020AT Annotation by Michelle Graham. TAIR10: lipoxygenase 1 | chr1:20525798-20530143 FORWARD LENGTH=859 SoyBaseE_val: 6.00E-53ISS
GO:0006952GO-bp Annotation by Michelle Graham. GO Biological Process: defense response SoyBaseN/AISS
GO:0009611GO-bp Annotation by Michelle Graham. GO Biological Process: response to wounding SoyBaseN/AISS
GO:0009695GO-bp Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process SoyBaseN/AISS
GO:0009737GO-bp Annotation by Michelle Graham. GO Biological Process: response to abscisic acid stimulus SoyBaseN/AISS
GO:0009753GO-bp Annotation by Michelle Graham. GO Biological Process: response to jasmonic acid stimulus SoyBaseN/AISS
GO:0009816GO-bp Annotation by Michelle Graham. GO Biological Process: defense response to bacterium, incompatible interaction SoyBaseN/AISS
GO:0010311GO-bp Annotation by Michelle Graham. GO Biological Process: lateral root formation SoyBaseN/AISS
GO:0030397GO-bp Annotation by Michelle Graham. GO Biological Process: membrane disassembly SoyBaseN/AISS
GO:0034440GO-bp Annotation by Michelle Graham. GO Biological Process: lipid oxidation SoyBaseN/AISS
GO:0040007GO-bp Annotation by Michelle Graham. GO Biological Process: growth SoyBaseN/AISS
GO:0048364GO-bp Annotation by Michelle Graham. GO Biological Process: root development SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0009536GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plastid SoyBaseN/AISS
GO:0016165GO-mf Annotation by Michelle Graham. GO Molecular Function: lipoxygenase activity SoyBaseN/AISS
PTHR11771Panther LIPOXYGENASE JGI ISS
PTHR11771:SF2Panther LIPOXYGENASE JGI ISS
PF00305PFAM Lipoxygenase JGI ISS
UniRef100_Q43446UniRef Annotation by Michelle Graham. Most informative UniRef hit: Lipoxygenase n=2 Tax=Glycine max RepID=Q43446_SOYBN SoyBaseE_val: 2.00E-87ISS
UniRef100_UPI000233EBEFUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233EBEF related cluster n=1 Tax=unknown RepID=UPI000233EBEF SoyBaseE_val: 9.00E-93ISS

Expression Patterns of Glyma15g37370
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g37370 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma15g37370
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g37370
>Glyma15g37370.1   sequence type=CDS   gene model=Glyma15g37370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTGCTGTTAAAGGATCCATCTGCTCCCCATGGAGTTCAACTTTTGATTGAGGACTATCCTTATGCTTCTAATGGGCTAGAGATATGGGATGCTATCAAGTCTTGGGTGGAAGAATATGTCTCATTCTACTACAAGTCAGCTGAGGAACTTCAAAAAGACCCCGAGCTCCAAGCTTGGTGGAAAGAACTTGTAGAGATGGGTCATGGGGATTTCAAGGATAAGCCATGGTGGCAAAAGATGCAAACTCGTGAAGAGTTTAATCCTGAGAAGGAGTTTTTTAAGACTATTATTGGCAAGAAAGAGACCCTCATTGACCTTACAGTTATAGAAATTTTATCAAGGCACGCATCTGATGAGTTCTACCTTGGGCAGAGAGATGGTGAGGCCTTTAAGAGGTTTGGAAAGAATCTTGAAGAGATTGAAAAGAAGCTTATAGAGAAGAACAATGATGAGACATTGAGAAACCGCTATGGGCCGGCTAAAATGCCTTAG
Predicted protein sequences of Glyma15g37370
>Glyma15g37370.1   sequence type=predicted peptide   gene model=Glyma15g37370   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
LLLKDPSAPHGVQLLIEDYPYASNGLEIWDAIKSWVEEYVSFYYKSAEELQKDPELQAWWKELVEMGHGDFKDKPWWQKMQTREEFNPEKEFFKTIIGKKETLIDLTVIEILSRHASDEFYLGQRDGEAFKRFGKNLEEIEKKLIEKNNDETLRNRYGPAKMP*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo