SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g37060): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g37060): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g37060

Feature Type:gene_model
Chromosome:Gm15
Start:42630253
stop:42632220
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g37060
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G06970AT Annotation by Michelle Graham. TAIR10: Protein of unknown function (DUF810) | chr5:2158431-2166004 REVERSE LENGTH=1101 SoyBaseE_val: 5.00E-56ISS
GO:0007155GO-bp Annotation by Michelle Graham. GO Biological Process: cell adhesion SoyBaseN/AISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0010090GO-bp Annotation by Michelle Graham. GO Biological Process: trichome morphogenesis SoyBaseN/AISS
GO:0045010GO-bp Annotation by Michelle Graham. GO Biological Process: actin nucleation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_Q9FL49UniRef Annotation by Michelle Graham. Most informative UniRef hit: Similarity to unknown protein n=1 Tax=Arabidopsis thaliana RepID=Q9FL49_ARATH SoyBaseE_val: 2.00E-53ISS
UniRef100_UPI000233B760UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233B760 related cluster n=1 Tax=unknown RepID=UPI000233B760 SoyBaseE_val: 3.00E-68ISS

Expression Patterns of Glyma15g37060
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g37060 not represented in the dataset
Glyma15g37060 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g37060 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g231200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g37060
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g37060
>Glyma15g37060.1   sequence type=CDS   gene model=Glyma15g37060   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTTAAGTTTGACATAGTCAAATCTATGGTTGAACTTAGCCAACTTTATGATATTGTTGTGGAGCCTCTCAGGGATCGCATAGTTACAAGTCTTCTTCAGGCATCATTGGATGGCTTACTCCGTGTCAATCTTAGATGGGGTCCATCAAGAGAATTCTTTATATCTGGAGGTGACGGCCTCCCTCAGGGTGTTGTCGAAAATCAGGTTGCACGTGTTCGGCATGTGATCAACTTGCATGGCTATGAGACCCGAGAGTTGATTGAAGACTTGAAATCTGCTAGTGGCATGGAAATGCAAGGTGGCAAAAGCAAACTGGGAACTGATTCCAAAACTCTATTAAGAATATTATGCCACAGGAGCGACTCAGAAGCCTCTCAATTTCTGAAGAAACAATACAAAATACCCAGTTCTTCTTCTTAG
Predicted protein sequences of Glyma15g37060
>Glyma15g37060.1   sequence type=predicted peptide   gene model=Glyma15g37060   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VKFDIVKSMVELSQLYDIVVEPLRDRIVTSLLQASLDGLLRVNLRWGPSREFFISGGDGLPQGVVENQVARVRHVINLHGYETRELIEDLKSASGMEMQGGKSKLGTDSKTLLRILCHRSDSEASQFLKKQYKIPSSSS*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo