SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g37021

Feature Type:gene_model
Chromosome:Gm15
Start:42569884
stop:42575887
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g37021
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G13680AT Annotation by Michelle Graham. TAIR10: callose synthase 5 | chr2:5695124-5706134 FORWARD LENGTH=1923 SoyBaseE_val: 5.00E-11ISS
GO:0006075GO-bp Annotation by Michelle Graham. GO Biological Process: (1->3)-beta-D-glucan biosynthetic process SoyBaseN/AISS
GO:0009556GO-bp Annotation by Michelle Graham. GO Biological Process: microsporogenesis SoyBaseN/AISS
GO:0009827GO-bp Annotation by Michelle Graham. GO Biological Process: plant-type cell wall modification SoyBaseN/AISS
GO:0009846GO-bp Annotation by Michelle Graham. GO Biological Process: pollen germination SoyBaseN/AISS
GO:0009860GO-bp Annotation by Michelle Graham. GO Biological Process: pollen tube growth SoyBaseN/AISS
GO:0010208GO-bp Annotation by Michelle Graham. GO Biological Process: pollen wall assembly SoyBaseN/AISS
GO:0010584GO-bp Annotation by Michelle Graham. GO Biological Process: pollen exine formation SoyBaseN/AISS
GO:0080092GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of pollen tube growth SoyBaseN/AISS
GO:0000148GO-cc Annotation by Michelle Graham. GO Cellular Compartment: 1,3-beta-D-glucan synthase complex SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0016020GO-cc Annotation by Michelle Graham. GO Cellular Compartment: membrane SoyBaseN/AISS
GO:0003843GO-mf Annotation by Michelle Graham. GO Molecular Function: 1,3-beta-D-glucan synthase activity SoyBaseN/AISS
UniRef100_G7IL41UniRef Annotation by Michelle Graham. Most informative UniRef hit: Gibberellin 2-oxidase n=1 Tax=Medicago truncatula RepID=G7IL41_MEDTR SoyBaseE_val: 1.00E-10ISS
UniRef100_I1MGB6UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MGB6_SOYBN SoyBaseE_val: 4.00E-14ISS

Expression Patterns of Glyma15g37021
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g37021 not represented in the dataset
Glyma15g37021 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g37021 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g231000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g37021
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g37021
>Glyma15g37021.1   sequence type=CDS   gene model=Glyma15g37021   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTGGCCTCCAAATCTCTCTTCAAGATGGCGTGTGGAACCCAGTTGCCCCTGACCCCTTAGCTTTCTGTGTTAATGTGGGTGATCTCTTACAGGTTTATTTCAAGGACACTCAAATTTGGTATGCAATCTTCTTAACTTTGTGTGGTGGTCTTGTTGGAGCCTTTGATCGTCTAGGACAGGTCATCATAAATTTTATCTTATTTTTATCTTGTCATGTCCAAAGAGAATTTGAGATCCATTATCTTATTGACTTTTTCTTTTTTATGGATTAG
Predicted protein sequences of Glyma15g37021
>Glyma15g37021.1   sequence type=predicted peptide   gene model=Glyma15g37021   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVGLQISLQDGVWNPVAPDPLAFCVNVGDLLQVYFKDTQIWYAIFLTLCGGLVGAFDRLGQVIINFILFLSCHVQREFEIHYLIDFFFFMD*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo