Glyma15g36821 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g36821): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g36821): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g36821

Feature Type:	gene_model
Chromosome:	Gm15
Start:	42292165
stop:	42295154
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g36821

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G29530	AT	Annotation by Michelle Graham. TAIR10: Tim10/DDP family zinc finger protein \| chr2:12641026-12642243 REVERSE LENGTH=83	SoyBase	E_val: 4.00E-29	ISS
GO:0001510	GO-bp	Annotation by Michelle Graham. GO Biological Process: RNA methylation	SoyBase	N/A	ISS
GO:0006626	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion	SoyBase	N/A	ISS
GO:0009853	GO-bp	Annotation by Michelle Graham. GO Biological Process: photorespiration	SoyBase	N/A	ISS
GO:0045039	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein import into mitochondrial inner membrane	SoyBase	N/A	ISS
GO:0005739	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion	SoyBase	N/A	ISS
GO:0005743	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial inner membrane	SoyBase	N/A	ISS
GO:0005758	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial intermembrane space	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0042719	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: mitochondrial intermembrane space protein transporter complex	SoyBase	N/A	ISS
GO:0015450	GO-mf	Annotation by Michelle Graham. GO Molecular Function: P-P-bond-hydrolysis-driven protein transmembrane transporter activity	SoyBase	N/A	ISS
PTHR11038	Panther	MITOCHONDRIAL IMPORT INNER MEMBRANE TRANSLOCASE SUBUNIT TIM10	JGI		ISS
PTHR11038:SF12	Panther	TIM10 (ARABIDOPSIS THALIANA TRANSLOCASE INNER MEMB	JGI		ISS
PF02953	PFAM	Tim10/DDP family zinc finger	JGI		ISS
UniRef100_G7IRZ4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Mitochondrial import inner membrane translocase subunit Tim10 n=1 Tax=Medicago truncatula RepID=G7IRZ4_MEDTR	SoyBase	E_val: 4.00E-29	ISS
UniRef100_UPI000233B9F0	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233B9F0 related cluster n=1 Tax=unknown RepID=UPI000233B9F0	SoyBase	E_val: 4.00E-33	ISS

Expression Patterns of Glyma15g36821

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g36821 not represented in the dataset	Glyma15g36821 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g36821 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g229800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g36821

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g36821

Limit To All Plant Sequences

>Glyma15g36821.1   sequence type=CDS   gene model=Glyma15g36821   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCTGAAAAGGAGATGGAATATAGGGTCGAATTATTCAACAAGATGACCCAGACCTGTTTCAATAAGTGTGTTGACAATAGGTATAAGGAGTCTGAGCTAAATATGGGTGAAAATAGTTGCATTGACCACTGTGCTTCAAAATATTGGCATGTAAGATGTTACTTAAGTTTACTTTTGGATCTATCACTGGCACTGTTTTGA

Predicted protein sequences of Glyma15g36821

Limit To All Plant Sequences

>Glyma15g36821.1   sequence type=predicted peptide   gene model=Glyma15g36821   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAEKEMEYRVELFNKMTQTCFNKCVDNRYKESELNMGENSCIDHCASKYWHVRCYLSLLLDLSLALF*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain