|
A newer version of this gene model can be found here:
| Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
|---|---|---|---|---|---|
| AT1G19360 | AT | Annotation by Michelle Graham. TAIR10: Nucleotide-diphospho-sugar transferase family protein | chr1:6690672-6692211 REVERSE LENGTH=428 | SoyBase | E_val: 3.00E-31 | ISS |
| GO:0009744 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to sucrose stimulus | SoyBase | N/A | ISS |
| GO:0009749 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to glucose stimulus | SoyBase | N/A | ISS |
| GO:0009750 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to fructose stimulus | SoyBase | N/A | ISS |
| GO:0080147 | GO-bp | Annotation by Michelle Graham. GO Biological Process: root hair cell development | SoyBase | N/A | ISS |
| GO:0005768 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: endosome | SoyBase | N/A | ISS |
| GO:0005783 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum | SoyBase | N/A | ISS |
| GO:0005794 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: Golgi apparatus | SoyBase | N/A | ISS |
| GO:0005802 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: trans-Golgi network | SoyBase | N/A | ISS |
| PTHR10994 | Panther | RETICULON/NOGO | JGI | ISS | |
| PTHR10994:SF3 | Panther | HISTONE H4 - RELATED | JGI | ISS | |
| UniRef100_I1LJG0 | UniRef | Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LJG0_SOYBN | SoyBase | E_val: 2.00E-48 | ISS |
|
Glyma15g36810 not represented in the dataset |
Glyma15g36810 not represented in the dataset |
| Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
| Corresponding Name | Annotation Version | Evidence | Comments |
|---|---|---|---|
| Glyma.15g229700 | Wm82.a2.v1 | IGC | As supplied by JGI |
| Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma15g36810.1 sequence type=CDS gene model=Glyma15g36810 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high ATGTTTGGAGTAATGGTGATTGTTTATTTGGCTTCTGAATCTAGTAAGTTTTGGGAAAATTCTCTTAGAACAGAGTCAAATCAAGGGAAAGAACAGGCTCAAAAGCAGTTCCTTACATTAGGAAAACAGCCTAAATCTAGACCTTTTGCTACTGTAAAGGGATTAAGAGCCAACACTACTGTTGTTCCTCATCAATCTGTGAATCCAAGATTGGAAAAGATATTAGAGAAAGTTCTAGTTAAACAAGAGGTTTTAGTGTGTCATGCAAACACCAATGTGAAGGAGATGCTGGAGGTCTGGTTCACCAATATCAACAGAGTTGGCATAACCAATTATCTAGTTGCTGCTTTAGACGATGAGACTGCATAG
>Glyma15g36810.1 sequence type=predicted peptide gene model=Glyma15g36810 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high MFGVMVIVYLASESSKFWENSLRTESNQGKEQAQKQFLTLGKQPKSRPFATVKGLRANTTVVPHQSVNPRLEKILEKVLVKQEVLVCHANTNVKEMLEVWFTNINRVGITNYLVAALDDETA*
| Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||