SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g36610

Feature Type:gene_model
Chromosome:Gm15
Start:41939384
stop:41940412
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g36610
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G08620AT Annotation by Michelle Graham. TAIR10: RNA-binding KH domain-containing protein | chr3:2617925-2620314 FORWARD LENGTH=283 SoyBaseE_val: 1.00E-23ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0010048GO-bp Annotation by Michelle Graham. GO Biological Process: vernalization response SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0003676GO-mf Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding SoyBaseN/AISS
GO:0003723GO-mf Annotation by Michelle Graham. GO Molecular Function: RNA binding SoyBaseN/AISS
PTHR11208Panther RNA-BINDING PROTEIN RELATED JGI ISS
PTHR11208:SF28Panther JGI ISS
UniRef100_C6TB13UniRef Annotation by Michelle Graham. Best UniRef hit: Putative uncharacterized protein n=1 Tax=Glycine max RepID=C6TB13_SOYBN SoyBaseE_val: 1.00E-23ISS
UniRef100_G7KY84UniRef Annotation by Michelle Graham. Most informative UniRef hit: KH domain-containing protein n=1 Tax=Medicago truncatula RepID=G7KY84_MEDTR SoyBaseE_val: 8.00E-22ISS

Expression Patterns of Glyma15g36610
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g36610 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g228700 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g36610
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g36610
>Glyma15g36610.1   sequence type=CDS   gene model=Glyma15g36610   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TTCTACTTCTTGACCATGTTCTTTCCTTGCTTTCCATTTTGTTTTGTTGGAAGGTTTCTGAGACCTAGAGACAATTCTCTGAAACAGGTAGAAGCTTCTAGAGGTTGTCGTGTGTATATTAGAGGAAAGGAAGAAAAAATTAAGAGGAAGACCAGGCAGCATCCCAATGAGCAATCCCACATTTTGATTGAGGTTGATTTACTTGCTAATATTGTTGACATAAGGCTTTGGCAAGCTCAAGAAATTATAGAATTGCTCAAACCTACGGGTTACTTTCATCTTTGGTGCGACCCATTTGACTCAGTGATATTCAAGGCATCGATTACGAAGGGAACATGTCCTGTAAATCCTATCGTGCGAGAATTGTAA
Predicted protein sequences of Glyma15g36610
>Glyma15g36610.1   sequence type=predicted peptide   gene model=Glyma15g36610   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
FYFLTMFFPCFPFCFVGRFLRPRDNSLKQVEASRGCRVYIRGKEEKIKRKTRQHPNEQSHILIEVDLLANIVDIRLWQAQEIIELLKPTGYFHLWCDPFDSVIFKASITKGTCPVNPIVREL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo