Glyma15g36011 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g36011): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g36011): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g36011

Feature Type:	gene_model
Chromosome:	Gm15
Start:	40998035
stop:	40998889
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g36011

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G51920	AT	Annotation by Michelle Graham. TAIR10: Pyridoxal phosphate (PLP)-dependent transferases superfamily protein \| chr5:21097202-21098914 REVERSE LENGTH=570	SoyBase	E_val: 7.00E-40	ISS
GO:0008152	GO-bp	Annotation by Michelle Graham. GO Biological Process: metabolic process	SoyBase	N/A	ISS
GO:0003824	GO-mf	Annotation by Michelle Graham. GO Molecular Function: catalytic activity	SoyBase	N/A	ISS
GO:0030170	GO-mf	Annotation by Michelle Graham. GO Molecular Function: pyridoxal phosphate binding	SoyBase	N/A	ISS
PTHR14237	Panther	MOLYBDOPTERIN COFACTOR SULFURASE (MOSC)	JGI		ISS
PTHR14237:SF3	Panther	gb def: hypothetical protein [arabidopsis thaliana]	JGI		ISS
UniRef100_G7IC19	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Molybdenum cofactor sulfurase n=1 Tax=Medicago truncatula RepID=G7IC19_MEDTR	SoyBase	E_val: 2.00E-84	ISS
UniRef100_UPI0002339EE1	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI0002339EE1 related cluster n=1 Tax=unknown RepID=UPI0002339EE1	SoyBase	E_val: 5.00E-114	ISS

Expression Patterns of Glyma15g36011

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g36011 not represented in the dataset	Glyma15g36011 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g36011 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g226700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g36011

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g36011

Limit To All Plant Sequences

>Glyma15g36011.1   sequence type=CDS   gene model=Glyma15g36011   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAAGTTCCTCAACATTTCTGACAATGACTACTTCATGGTTTTCACAACAAACAGAACCTCAGCTTTTAAGCTTGTGGCAGACTCATATCCATTCCAATCTAGCAAGAAGCTTCTGACAGTTTATGACTATGAGAATGAGGCAGTGGAAGCAATGATTAGTTGCTCAGAGAAGAGAGGAGCCAAGGCACATAGCAGCACCTGCAAAACCAAAAGAAGAGGGGTTTCCCTAGTCAAGATTTATGGTCCTAAGGTGAAATTTGATAGGGGACCTGCTTTGGCTTTCAATGTGTTTGATTGGAAAGGTGAAAAGGTTGAGCCTGTCCTTGTACAGAAGCTTGCTGATAGGAACAATATATCTCTCAGCTATGGATTTCTCCATCATGTTTGGTTTGCAGATAAGTATGCAGAAGACAAGGGGAAAGTTCTACAGACCAAAGAAGGAAGAGTCCAAGGAGTTACCACCAACAAGAAGAAAGATAGAGATGAGCTAGGAGTAACTATGGTTACTGCTGCATTAAGCTTCCTGGCTAATTTTGAAGATGTATATAAACTATGGACTTTTGTTGCCAGGTTCCTTGATGCTGATTTTGTGGAGAAGGAGAGATGGAGATTCACAACTCTCAATCAGAAAACAATTGAAGTTTAA

Predicted protein sequences of Glyma15g36011

Limit To All Plant Sequences

>Glyma15g36011.1   sequence type=predicted peptide   gene model=Glyma15g36011   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MKFLNISDNDYFMVFTTNRTSAFKLVADSYPFQSSKKLLTVYDYENEAVEAMISCSEKRGAKAHSSTCKTKRRGVSLVKIYGPKVKFDRGPALAFNVFDWKGEKVEPVLVQKLADRNNISLSYGFLHHVWFADKYAEDKGKVLQTKEGRVQGVTTNKKKDRDELGVTMVTAALSFLANFEDVYKLWTFVARFLDADFVEKERWRFTTLNQKTIEV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain