SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g35825): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g35825): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g35825

Feature Type:gene_model
Chromosome:Gm15
Start:40615484
stop:40616331
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g35825
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G42150AT Annotation by Michelle Graham. TAIR10: Glutathione S-transferase family protein | chr5:16846247-16847909 FORWARD LENGTH=315 SoyBaseE_val: 3.00E-27ISS
GO:0006626GO-bp Annotation by Michelle Graham. GO Biological Process: protein targeting to mitochondrion SoyBaseN/AISS
GO:0009407GO-bp Annotation by Michelle Graham. GO Biological Process: toxin catabolic process SoyBaseN/AISS
GO:0010583GO-bp Annotation by Michelle Graham. GO Biological Process: response to cyclopentenone SoyBaseN/AISS
GO:0045454GO-bp Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0009055GO-mf Annotation by Michelle Graham. GO Molecular Function: electron carrier activity SoyBaseN/AISS
GO:0015035GO-mf Annotation by Michelle Graham. GO Molecular Function: protein disulfide oxidoreductase activity SoyBaseN/AISS
PTHR12782Panther MICROSOMAL PROSTAGLANDIN E SYNTHASE-2 JGI ISS
PTHR12782:SF5Panther SUBFAMILY NOT NAMED JGI ISS
UniRef100_G7KPS4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Prostaglandin E synthase n=1 Tax=Medicago truncatula RepID=G7KPS4_MEDTR SoyBaseE_val: 1.00E-43ISS
UniRef100_I1L463UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1L463_SOYBN SoyBaseE_val: 2.00E-66ISS

Expression Patterns of Glyma15g35825
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g35825 not represented in the dataset
Glyma15g35825 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g35825 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments

References for Glyma15g35825
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g35825
>Glyma15g35825.1   sequence type=CDS   gene model=Glyma15g35825   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGAGAAGAGTACCTTCCAAATGTGATGCCATGAGAAAGGTACCTTCCATTCTCTTCAGAACACTTGCTGCCCCTCGCGCCACCACCTTTTTCACTGTCCCCAACTGCTTTCTCCAGGCTGTGCTCTACGGCAGCGCCACCGCTACCGCTTCTCCTCCCTCCAAGGAAGTCCTCGCCAAGGAGCCCCCACTGCCAGAGGCTCTCCCAATCAACATCGTTCTCTACCAGTTCGAGGCTTGCTATTTTTGCAACAAAGTCAAAGTTGTGGAGGTTAACCCTCCCAATAAGAAAGAAATCAAATGGACTGAGTATCAAAAGGTGCCAATATTGATGGTAGATGGCGAGCAGCTAAATGATTCATCAGTTATAATTGATAACCTGGGACATAAGATTTTGTCAAAGATAATTGTAGATTCAACTTTTGAGGATGAAGAGACAAAATGGCGGTGA
Predicted protein sequences of Glyma15g35825
>Glyma15g35825.1   sequence type=predicted peptide   gene model=Glyma15g35825   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MRRVPSKCDAMRKVPSILFRTLAAPRATTFFTVPNCFLQAVLYGSATATASPPSKEVLAKEPPLPEALPINIVLYQFEACYFCNKVKVVEVNPPNKKEIKWTEYQKVPILMVDGEQLNDSSVIIDNLGHKILSKIIVDSTFEDEETKWR*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo