Glyma15g35661 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g35661

Feature Type:	gene_model
Chromosome:	Gm15
Start:	40458463
stop:	40459409
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g35661

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G58570	AT	Annotation by Michelle Graham. TAIR10: P-loop containing nucleoside triphosphate hydrolases superfamily protein \| chr3:21657099-21660352 FORWARD LENGTH=646	SoyBase	E_val: 6.00E-44	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0003676	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding	SoyBase	N/A	ISS
GO:0004386	GO-mf	Annotation by Michelle Graham. GO Molecular Function: helicase activity	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0008026	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP-dependent helicase activity	SoyBase	N/A	ISS
PTHR24031	Panther	FAMILY NOT NAMED	JGI		ISS
PTHR24031:SF56	Panther	SUBFAMILY NOT NAMED	JGI		ISS
PF00270	PFAM	DEAD/DEAH box helicase	JGI		ISS
UniRef100_G7JA48	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: DEAD-box ATP-dependent RNA helicase n=1 Tax=Medicago truncatula RepID=G7JA48_MEDTR	SoyBase	E_val: 8.00E-43	ISS
UniRef100_I1LN14	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1LN14_SOYBN	SoyBase	E_val: 3.00E-45	ISS

Expression Patterns of Glyma15g35661

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g35661 not represented in the dataset	Glyma15g35661 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g35661 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g224800	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g35661

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g35661

Limit To All Plant Sequences

>Glyma15g35661.1   sequence type=CDS   gene model=Glyma15g35661   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGATCAGATATTTGGCCTTAGATGAGGCAGATAGAATGCTGGATATGGGTTTTGAGCCACAAATAAGGAAGATTGTAGAACAAATAGACATGCCCCCAGCAGGTGCTAGACAGACTATGTTACTTGCCTCTGATTTCCTTTCAAATAATATTTTTCTAGCTGTTGGAAGAGTGGGCTCAAGTACTGATTTAATTGTCCAAATAGTTGAGTATATTCAAGAGTCTACCAAGAGAAGTCACCTCATGGATCTTCTTCATGCATAG

Predicted protein sequences of Glyma15g35661

Limit To All Plant Sequences

>Glyma15g35661.1   sequence type=predicted peptide   gene model=Glyma15g35661   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MIRYLALDEADRMLDMGFEPQIRKIVEQIDMPPAGARQTMLLASDFLSNNIFLAVGRVGSSTDLIVQIVEYIQESTKRSHLMDLLHA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain