Glyma15g35435 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g35435): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g35435): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g35435

Feature Type:	gene_model
Chromosome:	Gm15
Start:	40058354
stop:	40058566
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g35435

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
ATCG01070	AT	Annotation by Michelle Graham. TAIR10: NADH-ubiquinone/plastoquinone oxidoreductase chain 4L \| chrC:117804-118109 REVERSE LENGTH=101	SoyBase	E_val: 2.00E-13	ISS
GO:0000096	GO-bp	Annotation by Michelle Graham. GO Biological Process: sulfur amino acid metabolic process	SoyBase	N/A	ISS
GO:0006091	GO-bp	Annotation by Michelle Graham. GO Biological Process: generation of precursor metabolites and energy	SoyBase	N/A	ISS
GO:0006354	GO-bp	Annotation by Michelle Graham. GO Biological Process: DNA-dependent transcription, elongation	SoyBase	N/A	ISS
GO:0006546	GO-bp	Annotation by Michelle Graham. GO Biological Process: glycine catabolic process	SoyBase	N/A	ISS
GO:0006636	GO-bp	Annotation by Michelle Graham. GO Biological Process: unsaturated fatty acid biosynthetic process	SoyBase	N/A	ISS
GO:0006733	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidoreduction coenzyme metabolic process	SoyBase	N/A	ISS
GO:0006744	GO-bp	Annotation by Michelle Graham. GO Biological Process: ubiquinone biosynthetic process	SoyBase	N/A	ISS
GO:0006766	GO-bp	Annotation by Michelle Graham. GO Biological Process: vitamin metabolic process	SoyBase	N/A	ISS
GO:0008652	GO-bp	Annotation by Michelle Graham. GO Biological Process: cellular amino acid biosynthetic process	SoyBase	N/A	ISS
GO:0009072	GO-bp	Annotation by Michelle Graham. GO Biological Process: aromatic amino acid family metabolic process	SoyBase	N/A	ISS
GO:0009106	GO-bp	Annotation by Michelle Graham. GO Biological Process: lipoate metabolic process	SoyBase	N/A	ISS
GO:0009108	GO-bp	Annotation by Michelle Graham. GO Biological Process: coenzyme biosynthetic process	SoyBase	N/A	ISS
GO:0009117	GO-bp	Annotation by Michelle Graham. GO Biological Process: nucleotide metabolic process	SoyBase	N/A	ISS
GO:0009695	GO-bp	Annotation by Michelle Graham. GO Biological Process: jasmonic acid biosynthetic process	SoyBase	N/A	ISS
GO:0015979	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis	SoyBase	N/A	ISS
GO:0019288	GO-bp	Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate-independent pathway	SoyBase	N/A	ISS
GO:0019684	GO-bp	Annotation by Michelle Graham. GO Biological Process: photosynthesis, light reaction	SoyBase	N/A	ISS
GO:0019748	GO-bp	Annotation by Michelle Graham. GO Biological Process: secondary metabolic process	SoyBase	N/A	ISS
GO:0042773	GO-bp	Annotation by Michelle Graham. GO Biological Process: ATP synthesis coupled electron transport	SoyBase	N/A	ISS
GO:0044272	GO-bp	Annotation by Michelle Graham. GO Biological Process: sulfur compound biosynthetic process	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009534	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid	SoyBase	N/A	ISS
GO:0009535	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast thylakoid membrane	SoyBase	N/A	ISS
GO:0003959	GO-mf	Annotation by Michelle Graham. GO Molecular Function: NADPH dehydrogenase activity	SoyBase	N/A	ISS
GO:0016651	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on NAD(P)H	SoyBase	N/A	ISS
UniRef100_Q2PMN4	UniRef	Annotation by Michelle Graham. Best UniRef hit: NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic n=1 Tax=Glycine max RepID=NU4LC_SOYBN	SoyBase	E_val: 1.00E-15	ISS
UniRef100_Q2PMN4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: NAD(P)H-quinone oxidoreductase subunit 4L, chloroplastic n=1 Tax=Glycine max RepID=NU4LC_SOYBN	SoyBase	E_val: 1.00E-15	ISS

Expression Patterns of Glyma15g35435

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g35435 not represented in the dataset	Glyma15g35435 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g35435 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma15g35435

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g35435

Limit To All Plant Sequences

>Glyma15g35435.1   sequence type=CDS   gene model=Glyma15g35435   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
TGGAATATGGTTAGAGCCCTTATGTGTTATTGTCTTGAACTTATACTGAATACAGTTAATATAAATCTCGTAACCTTTTTTGATTTTTTTGATAGTCGACAATTAAAAGGAAATATTTTTTCAATTTTTGTTATAGCTATTGCAACTGCCTATCGGAGCTATTGTTTGGAGTTTTATAAGTGGTGTATGTATGACAATGATATTTTTGTTTGA

Predicted protein sequences of Glyma15g35435

Limit To All Plant Sequences

>Glyma15g35435.1   sequence type=predicted peptide   gene model=Glyma15g35435   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
WNMVRALMCYCLELILNTVNINLVTFFDFFDSRQLKGNIFSIFVIAIATAYRSYCLEFYKWCMYDNDIFV*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain