Glyma15g34821 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g34821): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g34821): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g34821

Feature Type:	gene_model
Chromosome:	Gm15
Start:	39365079
stop:	39366189
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g34821

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G70070	AT	Annotation by Michelle Graham. TAIR10: DEAD/DEAH box helicase, putative \| chr1:26390016-26394148 REVERSE LENGTH=1171	SoyBase	E_val: 2.00E-27	ISS
GO:0009793	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy	SoyBase	N/A	ISS
GO:0010497	GO-bp	Annotation by Michelle Graham. GO Biological Process: plasmodesmata-mediated intercellular transport	SoyBase	N/A	ISS
GO:0016441	GO-bp	Annotation by Michelle Graham. GO Biological Process: posttranscriptional gene silencing	SoyBase	N/A	ISS
GO:0016556	GO-bp	Annotation by Michelle Graham. GO Biological Process: mRNA modification	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0010494	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasmic stress granule	SoyBase	N/A	ISS
GO:0003676	GO-mf	Annotation by Michelle Graham. GO Molecular Function: nucleic acid binding	SoyBase	N/A	ISS
GO:0003724	GO-mf	Annotation by Michelle Graham. GO Molecular Function: RNA helicase activity	SoyBase	N/A	ISS
GO:0004386	GO-mf	Annotation by Michelle Graham. GO Molecular Function: helicase activity	SoyBase	N/A	ISS
GO:0005524	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP binding	SoyBase	N/A	ISS
GO:0008026	GO-mf	Annotation by Michelle Graham. GO Molecular Function: ATP-dependent helicase activity	SoyBase	N/A	ISS
GO:0016818	GO-mf	Annotation by Michelle Graham. GO Molecular Function: hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides	SoyBase	N/A	ISS
UniRef100_B9DFG3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: DEAD-box ATP-dependent RNA helicase ISE2, chloroplastic n=1 Tax=Arabidopsis thaliana RepID=ISE2_ARATH	SoyBase	E_val: 7.00E-25	ISS
UniRef100_I1NE30	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1NE30_SOYBN	SoyBase	E_val: 2.00E-49	ISS

Expression Patterns of Glyma15g34821

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g34821 not represented in the dataset	Glyma15g34821 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g34821 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g221900	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g34821

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g34821

Limit To All Plant Sequences

>Glyma15g34821.1   sequence type=CDS   gene model=Glyma15g34821   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTCCCTTCTGGTCCTAGTAACTATGGAGGAGGCGCGTCATGCAGTGATGTCCTCGACCTCAACCTTCTGCGCCTTCTCCAACGCCGAGGAGGATGAAGAAGACGATGATGAAAAAGAAGACCAAGACAACGTTTTTGCTGACGAATACGATGACGTTTCGGGTGAGGCTTTCGACGAGGCCGACGTGTTCGCTCGGCACGATGGATTCAAGTGGCAGAGAGTCGACAAGCTATGCAACGAAGTCATGGAGTTCGGCGCCGATCTCATCGACGTCGACGAGCTCGCCTCCGTCTACGACTTCCGCATCGACAAGTTTCAGCGGCAGGCGATATTGGCTTTTCTGAGACGCTTCTCGGTGGTGGTTTCCACTCTGACGAGCAGCGGGAAGATGCTGATTGCGGAGGCCGCGGCTGTGGCCACGGTGGCTAGGGGATAG

Predicted protein sequences of Glyma15g34821

Limit To All Plant Sequences

>Glyma15g34821.1   sequence type=predicted peptide   gene model=Glyma15g34821   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MSLLVLVTMEEARHAVMSSTSTFCAFSNAEEDEEDDDEKEDQDNVFADEYDDVSGEAFDEADVFARHDGFKWQRVDKLCNEVMEFGADLIDVDELASVYDFRIDKFQRQAILAFLRRFSVVVSTLTSSGKMLIAEAAAVATVARG*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain