|
A newer version of this gene model can be found here:
Database ID | Annotation Type | Annotation Description | Annotation Source | Match Score | Evidence Code |
---|---|---|---|---|---|
AT1G05260 | AT | Annotation by Michelle Graham. TAIR10: Peroxidase superfamily protein | chr1:1529827-1531271 FORWARD LENGTH=326 | SoyBase | E_val: 3.00E-40 | ISS |
GO:0006826 | GO-bp | Annotation by Michelle Graham. GO Biological Process: iron ion transport | SoyBase | N/A | ISS |
GO:0006979 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to oxidative stress | SoyBase | N/A | ISS |
GO:0009269 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to desiccation | SoyBase | N/A | ISS |
GO:0009409 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to cold | SoyBase | N/A | ISS |
GO:0010054 | GO-bp | Annotation by Michelle Graham. GO Biological Process: trichoblast differentiation | SoyBase | N/A | ISS |
GO:0010106 | GO-bp | Annotation by Michelle Graham. GO Biological Process: cellular response to iron ion starvation | SoyBase | N/A | ISS |
GO:0010167 | GO-bp | Annotation by Michelle Graham. GO Biological Process: response to nitrate | SoyBase | N/A | ISS |
GO:0015706 | GO-bp | Annotation by Michelle Graham. GO Biological Process: nitrate transport | SoyBase | N/A | ISS |
GO:0016132 | GO-bp | Annotation by Michelle Graham. GO Biological Process: brassinosteroid biosynthetic process | SoyBase | N/A | ISS |
GO:0042538 | GO-bp | Annotation by Michelle Graham. GO Biological Process: hyperosmotic salinity response | SoyBase | N/A | ISS |
GO:0055114 | GO-bp | Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process | SoyBase | N/A | ISS |
GO:0005576 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: extracellular region | SoyBase | N/A | ISS |
GO:0005783 | GO-cc | Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum | SoyBase | N/A | ISS |
GO:0004601 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: peroxidase activity | SoyBase | N/A | ISS |
GO:0020037 | GO-mf | Annotation by Michelle Graham. GO Molecular Function: heme binding | SoyBase | N/A | ISS |
PF00141 | PFAM | Peroxidase | JGI | ISS | |
UniRef100_Q9ZNZ6 | UniRef | Annotation by Michelle Graham. Most informative UniRef hit: Peroxidase (Fragment) n=1 Tax=Glycine max RepID=Q9ZNZ6_SOYBN | SoyBase | E_val: 2.00E-49 | ISS |
UniRef100_UPI000233B732 | UniRef | Annotation by Michelle Graham. Best UniRef hit: UPI000233B732 related cluster n=1 Tax=unknown RepID=UPI000233B732 | SoyBase | E_val: 4.00E-60 | ISS |
Glyma15g34690 not represented in the dataset |
Glyma15g34690 not represented in the dataset |
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection |
Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome |
Corresponding Name | Annotation Version | Evidence | Comments |
---|
Schmutz et al. 2010 Genome sequence of the palaeopolyploid soybean Nature 2010, 463:178-183 |
>Glyma15g34690.1 sequence type=CDS gene model=Glyma15g34690 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high CTTGGTTTTTATGTTAACAGTTGCCCAAAAATAGAGCAAATTGTTTTGAAATTTGTTCATGACCATATCCATAATGCTCCATCACTAGCAGCTGCATTAATAAGAATGCACTTTCATGACTGTTTTGTAAGGGGATGTGATGCATCAGCCCTTTTGAACTCAACAACCAATCAGGTTGAGAAGAATGCTCGTCCAAATCTTACAGTAAGAGGCTTTGACTTCATTGGCATTATAAAGAGCCTTGTTGAAGCTGAATGCCATGGTGTGGTCTCTTGA
>Glyma15g34690.1 sequence type=predicted peptide gene model=Glyma15g34690 sequence assembly version=Glyma 1.0 annotation version=1.1 JGI Gene Call confidence=high LGFYVNSCPKIEQIVLKFVHDHIHNAPSLAAALIRMHFHDCFVRGCDASALLNSTTNQVEKNARPNLTVRGFDFIGIIKSLVEAECHGVVS*
Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA | ||