Glyma15g34670 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g34670): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g34670): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g34670

Feature Type:	gene_model
Chromosome:	Gm15
Start:	39184774
stop:	39186455
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g34670

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G62890	AT	Annotation by Michelle Graham. TAIR10: Xanthine/uracil permease family protein \| chr5:25243723-25246748 FORWARD LENGTH=476	SoyBase	E_val: 6.00E-28	ISS
GO:0006810	GO-bp	Annotation by Michelle Graham. GO Biological Process: transport	SoyBase	N/A	ISS
GO:0055085	GO-bp	Annotation by Michelle Graham. GO Biological Process: transmembrane transport	SoyBase	N/A	ISS
GO:0005618	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cell wall	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0005783	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: endoplasmic reticulum	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0009506	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0005215	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transporter activity	SoyBase	N/A	ISS
GO:0022857	GO-mf	Annotation by Michelle Graham. GO Molecular Function: transmembrane transporter activity	SoyBase	N/A	ISS
PTHR11119	Panther	PURINE PERMEASE	JGI		ISS
PTHR11119:SF8	Panther	SODIUM-DEPENDENT VITAMIN C TRANSPORTER	JGI		ISS
UniRef100_G7JNU5	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Nucleobase ascorbate transporter n=1 Tax=Medicago truncatula RepID=G7JNU5_MEDTR	SoyBase	E_val: 2.00E-27	ISS
UniRef100_I1MTK0	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MTK0_SOYBN	SoyBase	E_val: 7.00E-28	ISS

Expression Patterns of Glyma15g34670

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g34670 not represented in the dataset	Glyma15g34670 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g34670 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g221100	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g34670

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g34670

Limit To All Plant Sequences

>Glyma15g34670.1   sequence type=CDS   gene model=Glyma15g34670   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTTATCAATGGCATTAGCTGATACTGATGTGGTCGTTGACATCGCATTGTTGTGCTACACATTCATAGCATACCAGCCTTTCAGAAAAGCAAGCCAAATTTCTTTTAGGCTATGTGCTGTTATTGTTGCTTCAACTCTTCAAATAGTACTAGGCTTTAGTGGCCTTTGGCGTAATGTTGCAAGGTTCTTGAGTCCACTTTCAGCAGTCCCTTTGGTATCTCATGTTGGTTTTGGGCTTTATGAGTTGGGCTTTCCTGGGGTTGCTAAATGTATAGAGATTGGACTGCCAGAGCTTATATATTACTATTTGTACCCCATGTGCTACATTAAGGAAAACATGTCTTTGATCGGTTCGTTGTTTTATTTACAATTGCAATTGTGTGGTTATATGCTTACCTGCTCACTGTTGGAGGGGCATACAATCATGCTGCACCTAAAACACAACTGTTTCAGCTTAATGAATTGTTCCTTACAGAGCCTCAAAAGTCTAGGATTTATCATTACTATGTACTTGTCTTTCTCTGGTGCATGTGAACAACAAATTACTGAGCATCAGTCCAAGTTCAAAGATGGAGAAGATATACCTCCTTTAGTGGGATGCTACATACTTGTCGCTCTCTCTGCCATAGGAGTTTTCGTTTTATTTGTCAGTCATGTTTTAGCTCTATAA

Predicted protein sequences of Glyma15g34670

Limit To All Plant Sequences

>Glyma15g34670.1   sequence type=predicted peptide   gene model=Glyma15g34670   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MLSMALADTDVVVDIALLCYTFIAYQPFRKASQISFRLCAVIVASTLQIVLGFSGLWRNVARFLSPLSAVPLVSHVGFGLYELGFPGVAKCIEIGLPELIYYYLYPMCYIKENMSLIGSLFYLQLQLCGYMLTCSLLEGHTIMLHLKHNCFSLMNCSLQSLKSLGFIITMYLSFSGACEQQITEHQSKFKDGEDIPPLVGCYILVALSAIGVFVLFVSHVLAL*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain