SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g34653

Feature Type:gene_model
Chromosome:Gm15
Start:39178579
stop:39182949
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g34653
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT5G04920AT Annotation by Michelle Graham. TAIR10: EAP30/Vps36 family protein | chr5:1439172-1441545 REVERSE LENGTH=440 SoyBaseE_val: 2.00E-56ISS
GO:0016192GO-bp Annotation by Michelle Graham. GO Biological Process: vesicle-mediated transport SoyBaseN/AISS
GO:0000814GO-cc Annotation by Michelle Graham. GO Cellular Compartment: ESCRT II complex SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0005215GO-mf Annotation by Michelle Graham. GO Molecular Function: transporter activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
PTHR13128Panther FAMILY NOT NAMED JGI ISS
PTHR13128:SF5Panther gb def: Arabidopsis thaliana genomic DNA, chromosome 5, P1 clone:MUG13 (Hypothetical pro JGI ISS
PF04157PFAM EAP30/Vps36 family JGI ISS
UniRef100_G7L707UniRef Annotation by Michelle Graham. Most informative UniRef hit: Vacuolar protein sorting protein n=1 Tax=Medicago truncatula RepID=G7L707_MEDTR SoyBaseE_val: 2.00E-64ISS
UniRef100_I1KVX9UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1KVX9_SOYBN SoyBaseE_val: 1.00E-69ISS

Expression Patterns of Glyma15g34653
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g34653 not represented in the dataset
Glyma15g34653 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma15g34653
ParalogEvidenceComments
Glyma08g24460 IGC Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma15g34653 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g221000 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g34653
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g34653
>Glyma15g34653.1   sequence type=CDS   gene model=Glyma15g34653   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTGATGCTAGCAGAGAAAATGAGGCTAAAACTTTTGTCTGGCTCAAATTCTCAAACCAATGCGACTAATGATGAGGAGATGGGTTCAAAGGAAGAGATGCAAGATTGGTTATTGAGTGTTGGTATTATATCCCCTGTTACCAAAGAGTCTGTGGGTGCTTTGTATCATCAACAACTTTCTCGTCAGTTGGCAGATTTTGTTAAAGTTCCACTTGAGAAAGCTGGGGGAATTATCAATCTTATTGATATATATTGTCTCTTCAATCATGCTTGTGGCATAGAATTGATCTCACCTGATGATTTGTTGCAAGCATCTTCTCTGTGGGAGAAGTTTGATGTGTATGTTTTACATTATCTTCTATTTAAATTACTTCTGTTACTGTGA
Predicted protein sequences of Glyma15g34653
>Glyma15g34653.1   sequence type=predicted peptide   gene model=Glyma15g34653   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVMLAEKMRLKLLSGSNSQTNATNDEEMGSKEEMQDWLLSVGIISPVTKESVGALYHQQLSRQLADFVKVPLEKAGGIINLIDIYCLFNHACGIELISPDDLLQASSLWEKFDVYVLHYLLFKLLLLL*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo