Glyma15g34540 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g34540): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g34540): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g34540

Feature Type:	gene_model
Chromosome:	Gm15
Start:	38971109
stop:	38972316
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g34540

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT3G06400	AT	Annotation by Michelle Graham. TAIR10: chromatin-remodeling protein 11 \| chr3:1941066-1946700 FORWARD LENGTH=1056	SoyBase	E_val: 4.00E-49	ISS
GO:0008284	GO-bp	Annotation by Michelle Graham. GO Biological Process: positive regulation of cell proliferation	SoyBase	N/A	ISS
GO:0009553	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo sac development	SoyBase	N/A	ISS
GO:0009630	GO-bp	Annotation by Michelle Graham. GO Biological Process: gravitropism	SoyBase	N/A	ISS
GO:0010228	GO-bp	Annotation by Michelle Graham. GO Biological Process: vegetative to reproductive phase transition of meristem	SoyBase	N/A	ISS
GO:0016049	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell growth	SoyBase	N/A	ISS
GO:0005634	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: nucleus	SoyBase	N/A	ISS
GO:0005829	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytosol	SoyBase	N/A	ISS
GO:0005515	GO-mf	Annotation by Michelle Graham. GO Molecular Function: protein binding	SoyBase	N/A	ISS
GO:0008094	GO-mf	Annotation by Michelle Graham. GO Molecular Function: DNA-dependent ATPase activity	SoyBase	N/A	ISS
PTHR10799	Panther	ATP-DEPENDENT HELICASE SMARCA (SWI/SNF-RELATED MATRIX-ASSOCIATED ACTIN-DEPENDENT REGULATOR OF CHROMATIN A)-RELATED	JGI		ISS
PTHR10799:SF73	Panther	DNA REPAIR HELICASE-RELATED	JGI		ISS
PF09110	PFAM	HAND	JGI		ISS
UniRef100_G7ISH3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Chromatin remodeling complex subunit n=1 Tax=Medicago truncatula RepID=G7ISH3_MEDTR	SoyBase	E_val: 5.00E-53	ISS
UniRef100_I1MRF4	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MRF4_SOYBN	SoyBase	E_val: 4.00E-56	ISS

Expression Patterns of Glyma15g34540

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g34540 not represented in the dataset	Glyma15g34540 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g34540 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments

References for Glyma15g34540

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g34540

Limit To All Plant Sequences

>Glyma15g34540.1   sequence type=CDS   gene model=Glyma15g34540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGTACTTTATACCTTTGTTTATGATTTTTCAGGACATTTATGATGAGAACAAATTTGATTTCAAAAAAATTGTGAGTGAAAATTGGGTCGAGCCACCAAGAAGAGAATACAAGCGCAATTACTCAGAGTCTAAATACTTCAAGCAAACAATGCGCCAAGGTGGTCTTACTAAACCAAAAGAGCCTTGTATTCCTAGCATGCCTCAATTGCATGACTTCCAGTTTTTCAACACACACAGGCTGAGTGAGCTGTATGAAAAGGAAGTTCGCTACCTCATGCAAACACATCAGAAGAATCAGGTGAAAGATTCCATAGATGTTGATGAACCAGAAGATAGAAGGGTAAAAAAGGGTATTTTCTCGGAAGAAGATGAT

Predicted protein sequences of Glyma15g34540

Limit To All Plant Sequences

>Glyma15g34540.1   sequence type=predicted peptide   gene model=Glyma15g34540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MYFIPLFMIFQDIYDENKFDFKKIVSENWVEPPRREYKRNYSESKYFKQTMRQGGLTKPKEPCIPSMPQLHDFQFFNTHRLSELYEKEVRYLMQTHQKNQVKDSIDVDEPEDRRVKKGIFSEEDD

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain