SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Notice: fwrite(): Write of 156 bytes failed with errno=28 No space left on device in /var/www/html/include/SeqFeatClass.php on line 369

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g33750): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g33750): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g33750

Feature Type:gene_model
Chromosome:Gm15
Start:37588014
stop:37590209
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G53430AT Annotation by Michelle Graham. TAIR10: Leucine-rich repeat transmembrane protein kinase | chr1:19936073-19940959 FORWARD LENGTH=997 SoyBaseE_val: 1.00E-26ISS
GO:0006468GO-bp Annotation by Michelle Graham. GO Biological Process: protein phosphorylation SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0004713GO-mf Annotation by Michelle Graham. GO Molecular Function: protein tyrosine kinase activity SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
PTHR24420Panther FAMILY NOT NAMED JGI ISS
PTHR24420:SF697Panther JGI ISS
UniRef100_G7IQZ2UniRef Annotation by Michelle Graham. Most informative UniRef hit: Receptor-like serine/threonine kinase n=1 Tax=Medicago truncatula RepID=G7IQZ2_MEDTR SoyBaseE_val: 3.00E-27ISS
UniRef100_UPI000233D006UniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233D006 related cluster n=1 Tax=unknown RepID=UPI000233D006 SoyBaseE_val: 1.00E-36ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g33750 not represented in the dataset

Glyma15g33750 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma15g33750.1   sequence type=CDS   gene model=Glyma15g33750   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
AAATGGGCAGCATATTTTCTTAAAGTTCAAAGCAATCAATATTTCTTTGCCTCTATCAGATTTAGAGTGAATGATGGGGAGGACAGAATAGCTGTCCCTAGGCAAATGACTCCAAAATCAGTGAATCACCAAATTTGTTGTATCATCCTCTGTAAGCGAGGTCGAATAATTATATTTGTAATCCATGTTTACAGGATCTTGGAAGATAATCAACTTGAGGGACCTATTCCCCCGAGCCTTGGAAAAATGAGCAACTTGCTGAGATTACTTCTTTGTGCAAATAATTTCACAGGGATAATACCAGAAACATATGGAAATCTAAAGAATCTCACTCAGTTTAGGATAGATGGGAACACTTTATCTGGGAAAATACCCAATTTTATTGGGAACTGGACCAAACTTGATAGATTAAAACTTTTTGGAATTGAGGAATTGCTTAATAACTGGTCTCATTCCAAACTACATTGGAGAAATAGAAAGTTTGAAAACCATATATTTTTCAAGACTTATTTTTGGACACTCTTCATCTGTTTGTGTAATCATTGGGGCATGTCCTTTAAGGTGATTGTGATTTGTTGGTTAGTTATACCAGTATAA

>Glyma15g33750.1   sequence type=predicted peptide   gene model=Glyma15g33750   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
KWAAYFLKVQSNQYFFASIRFRVNDGEDRIAVPRQMTPKSVNHQICCIILCKRGRIIIFVIHVYRILEDNQLEGPIPPSLGKMSNLLRLLLCANNFTGIIPETYGNLKNLTQFRIDGNTLSGKIPNFIGNWTKLDRLKLFGIEELLNNWSHSKLHWRNRKFENHIFFKTYFWTLFICLCNHWGMSFKVIVICWLVIPV*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo