SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g32590): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g32590): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g32590

Feature Type:gene_model
Chromosome:Gm15
Start:36269006
stop:36271731
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT4G11820AT Annotation by Michelle Graham. TAIR10: hydroxymethylglutaryl-CoA synthase / HMG-CoA synthase / 3-hydroxy-3-methylglutaryl coenzyme A synthase | chr4:7109124-7111213 REVERSE LENGTH=406 SoyBaseE_val: 9.00E-55ISS
GO:0006084GO-bp Annotation by Michelle Graham. GO Biological Process: acetyl-CoA metabolic process SoyBaseN/AISS
GO:0008152GO-bp Annotation by Michelle Graham. GO Biological Process: metabolic process SoyBaseN/AISS
GO:0008299GO-bp Annotation by Michelle Graham. GO Biological Process: isoprenoid biosynthetic process SoyBaseN/AISS
GO:0019287GO-bp Annotation by Michelle Graham. GO Biological Process: isopentenyl diphosphate biosynthetic process, mevalonate pathway SoyBaseN/AISS
GO:0005739GO-cc Annotation by Michelle Graham. GO Cellular Compartment: mitochondrion SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0003824GO-mf Annotation by Michelle Graham. GO Molecular Function: catalytic activity SoyBaseN/AISS
GO:0004421GO-mf Annotation by Michelle Graham. GO Molecular Function: hydroxymethylglutaryl-CoA synthase activity SoyBaseN/AISS
PTHR11877Panther HYDROXYMETHYLGLUTARYL-COA SYNTHASE JGI ISS
PTHR11877:SF10Panther HMG-COA SYNTHASE JGI ISS
PF01154PFAM Hydroxymethylglutaryl-coenzyme A synthase N terminal JGI ISS
PF08540PFAM Hydroxymethylglutaryl-coenzyme A synthase C terminal JGI ISS
UniRef100_A9ZMZ7UniRef Annotation by Michelle Graham. Most informative UniRef hit: Hydroxymethylglutaryl-CoA synthase n=1 Tax=Hevea brasiliensis RepID=A9ZMZ7_HEVBR SoyBaseE_val: 6.00E-56ISS
UniRef100_I1MID8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1MID8_SOYBN SoyBaseE_val: 1.00E-96ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g32590 not represented in the dataset

Glyma15g32590 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma15g32590.2   sequence type=CDS   gene model=Glyma15g32590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
GTTACTTCACTTCTTGAAAAATTTAATGTTGATCTTAAGCAAATTGGACGTTTGGAGGTTGGGAGTGAAATTGTTATTGACAAAAGCAAATCAATTAAGACCTTCTTAGTGCAAGCTTTTGAGTGTGAAGGTGTTGATTCAACTAATGAATGCAATGGAGGAACAACTGCTTTGTTCAATTATGTGAATTGGGCAGATAGTAGTTCACGGGATGGGGCATTATGGACTTGTTGTATTTTACCAAGATATTACTTTTACAAGAAAGCATGGAACATGTTTTATTTTGAATGTCTACATGTCTCATTATTTGTATATGCTGAAGGACCTGCTTGTCCCACTGGAGGAGCAGCTGCAATTGCCATGCTCCTAGGACCAAATGCTCTTATTGCTTTTGAAAGCAAACTCAGAGGTAGTCACATGCCTCATGCTTATGATTTTTACAAGCCAAATCTTGCTAATGAATATCCAGTAATGCTTTGTCACCTCATTATTAATTTTAATTGCATCATAACTGTACTATGA

>Glyma15g32590.2   sequence type=predicted peptide   gene model=Glyma15g32590   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
VTSLLEKFNVDLKQIGRLEVGSEIVIDKSKSIKTFLVQAFECEGVDSTNECNGGTTALFNYVNWADSSSRDGALWTCCILPRYYFYKKAWNMFYFECLHVSLFVYAEGPACPTGGAAAIAMLLGPNALIAFESKLRGSHMPHAYDFYKPNLANEYPVMLCHLIINFNCIITVL*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo