Glyma15g32540 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g32540): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g32540): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g32540

Feature Type:	gene_model
Chromosome:	Gm15
Start:	36072748
stop:	36076487
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g32540

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT1G78630	AT	Annotation by Michelle Graham. TAIR10: Ribosomal protein L13 family protein \| chr1:29575997-29577406 FORWARD LENGTH=241	SoyBase	E_val: 4.00E-109	ISS
GO:0006412	GO-bp	Annotation by Michelle Graham. GO Biological Process: translation	SoyBase	N/A	ISS
GO:0009793	GO-bp	Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy	SoyBase	N/A	ISS
GO:0045036	GO-bp	Annotation by Michelle Graham. GO Biological Process: protein targeting to chloroplast	SoyBase	N/A	ISS
GO:0005840	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: ribosome	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009570	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast stroma	SoyBase	N/A	ISS
GO:0009579	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: thylakoid	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0003735	GO-mf	Annotation by Michelle Graham. GO Molecular Function: structural constituent of ribosome	SoyBase	N/A	ISS
KOG3203	KOG	Mitochondrial/chloroplast ribosomal protein L13	JGI		ISS
PTHR11545	Panther	RIBOSOMAL PROTEIN L13	JGI		ISS
PTHR11545:SF2	Panther	60S RIBOSOMAL PROTEIN L13A	JGI		ISS
PF00572	PFAM	Ribosomal protein L13	JGI		ISS
UniRef100_D7KVT4	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: EMB1473 n=1 Tax=Arabidopsis lyrata subsp. lyrata RepID=D7KVT4_ARALL	SoyBase	E_val: 1.00E-107	ISS
UniRef100_I1MID7	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MID7_SOYBN	SoyBase	E_val: 2.00E-179	ISS

Expression Patterns of Glyma15g32540

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g32540 not represented in the dataset	Glyma15g32540 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g32540 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g209000	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g32540

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g32540

Limit To All Plant Sequences

>Glyma15g32540.1   sequence type=CDS   gene model=Glyma15g32540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCGCTGCTGTGTGGTTCAACTTCCGTGACTCCATTCCTTTCTCACAAGAACGTTGGTTTCACAACCTCAGCAAAATCTTCCTTTGTTGGCTTTCAATTGCCGCTTCCAAAGCTCACATTATCTTCTTCCGTTCGAACCCTTCTGCCGGCAACATCCCGTGTCCGTTGCCAGCAAGAGTCTACTACTGTTACCCCTGTCGCAGAAGAAGACCCGCGCTTCGCGTGCGTCGAACCCGAACCCCGATTCAAAGGCCCGGACATTTGGAACAAGAGCTGGTATCCAAAAGCTGCAGATCATGTGAATACAGAAAAAACATGGTATGTTGTTGATGCTACAGACAAAGTTCTTGGAAGACTAGCATCGACGATTGCTATTCACATCCGAGGGAAAAACTTGGCAACCTACACACCCAGTGTGGACATGGGTGCGTTTGTAATTGTGGTAAATGCAGAAAAGGTTGCTGTATCTGGGAAAAAGAGGACCCAAAAGCTTTACAGGAGGCACTCTGGACGACCTGGTGGTATGACCGTGGAGACATTTGCCCAGCTGCAAAACAGAATTCCTGAAAGAATTATTGAACACGCTGTTCGTGGCATGCTTCCAAAAGGAAGGCTTGGGAGGAGACTATTCACCCACCTTAAGGTTTATAAAGGCCCAGATCATCCACATGCGGCGCAGAAGCCCGTTGAGTTGCCAATAAGGGATAAGAGAATACATTTGCAGAAATAG

Predicted protein sequences of Glyma15g32540

Limit To All Plant Sequences

>Glyma15g32540.1   sequence type=predicted peptide   gene model=Glyma15g32540   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MALLCGSTSVTPFLSHKNVGFTTSAKSSFVGFQLPLPKLTLSSSVRTLLPATSRVRCQQESTTVTPVAEEDPRFACVEPEPRFKGPDIWNKSWYPKAADHVNTEKTWYVVDATDKVLGRLASTIAIHIRGKNLATYTPSVDMGAFVIVVNAEKVAVSGKKRTQKLYRRHSGRPGGMTVETFAQLQNRIPERIIEHAVRGMLPKGRLGRRLFTHLKVYKGPDHPHAAQKPVELPIRDKRIHLQK*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain