Glyma15g32300 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g32300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g32300): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g32300

Feature Type:	gene_model
Chromosome:	Gm15
Start:	35855869
stop:	35858287
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g32300

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT2G18990	AT	Annotation by Michelle Graham. TAIR10: thioredoxin domain-containing protein 9 homolog \| chr2:8238851-8239932 REVERSE LENGTH=211	SoyBase	E_val: 1.00E-81	ISS
GO:0019932	GO-bp	Annotation by Michelle Graham. GO Biological Process: second-messenger-mediated signaling	SoyBase	N/A	ISS
GO:0045454	GO-bp	Annotation by Michelle Graham. GO Biological Process: cell redox homeostasis	SoyBase	N/A	ISS
GO:0005737	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm	SoyBase	N/A	ISS
PTHR21148	Panther	PHOSDUCIN-RELATED	JGI		ISS
PTHR21148:SF11	Panther	THIOREDOXIN DOMAIN CONTAINING PROTEIN 9-RELATED	JGI		ISS
PF00085	PFAM	Thioredoxin	JGI		ISS
UniRef100_B9RY61	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Thioredoxin domain-containing protein, putative n=1 Tax=Ricinus communis RepID=B9RY61_RICCO	SoyBase	E_val: 2.00E-81	ISS
UniRef100_I1MID5	UniRef	Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MID5_SOYBN	SoyBase	E_val: 1.00E-107	ISS

Expression Patterns of Glyma15g32300

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g32300 not represented in the dataset	Glyma15g32300 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g32300 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g219600	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g32300

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g32300

Limit To All Plant Sequences

>Glyma15g32300.2   sequence type=CDS   gene model=Glyma15g32300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGATAAGGGTAAGATCCAAGAGGTGATCGAGAACCAAGTCCTGACGGTGGCGCAAGCCGTCGAGGACAAGATCGACGATGAGATCGCCGCCCTGGAACGCCTCGATGCCGACGACATCGAAGCCCTCCGCGAGCATCGCCTCCAGCAGATGAAGAAGATGGCGGAGAAGCGCTCCCGCTGGATCTCCCTCGGCCACTCCGAATATTCCGAGATTCCCTCCAAGAAAGACTTCTTCTCCGTCGTCAAGGCCAGCGAACGCGTCGTTTGCCACTTCTTCCGCGAAAACTGGCCCTGCAAGGTTATGGACAAACATTTAAATATTTTGGCAAAGCAGCATATCGAGACTCGGTTTGTGAAACTCAACGCTGAGAAGAGTCCTTTTCTCGCTGAGAAGCTCAAGATCATTGTTCTTCCAACCCTTGCCCTCTCGCTATCTGGATCTCTCTTTTTCTTCGGTAGATAG

Predicted protein sequences of Glyma15g32300

Limit To All Plant Sequences

>Glyma15g32300.2   sequence type=predicted peptide   gene model=Glyma15g32300   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDKGKIQEVIENQVLTVAQAVEDKIDDEIAALERLDADDIEALREHRLQQMKKMAEKRSRWISLGHSEYSEIPSKKDFFSVVKASERVVCHFFRENWPCKVMDKHLNILAKQHIETRFVKLNAEKSPFLAEKLKIIVLPTLALSLSGSLFFFGR*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain