SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g31520

Feature Type:gene_model
Chromosome:Gm15
Start:34878041
stop:34879315
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g31520
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT1G70890AT Annotation by Michelle Graham. TAIR10: MLP-like protein 43 | chr1:26725912-26726489 REVERSE LENGTH=158 SoyBaseE_val: 3.00E-30ISS
GO:0006952GO-bp Annotation by Michelle Graham. GO Biological Process: defense response SoyBaseN/AISS
GO:0030003GO-bp Annotation by Michelle Graham. GO Biological Process: cellular cation homeostasis SoyBaseN/AISS
GO:0070838GO-bp Annotation by Michelle Graham. GO Biological Process: divalent metal ion transport SoyBaseN/AISS
GO:0009507GO-cc Annotation by Michelle Graham. GO Cellular Compartment: chloroplast SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
PF00407PFAM Pathogenesis-related protein Bet v I family JGI ISS
UniRef100_G7L8F9UniRef Annotation by Michelle Graham. Most informative UniRef hit: MLP-like protein n=1 Tax=Medicago truncatula RepID=G7L8F9_MEDTR SoyBaseE_val: 3.00E-64ISS
UniRef100_I1MIC0UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MIC0_SOYBN SoyBaseE_val: 5.00E-136ISS

Expression Patterns of Glyma15g31520
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g31520 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g218900 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g31520
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g31520
>Glyma15g31520.1   sequence type=CDS   gene model=Glyma15g31520   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTCTTTTTAAGTCACATTTGTTCGCAATATTCATCCCCATCTCCCATCTTTGTTTGTTCCATCTCTTGCTTCTTGCTTCTATTACTTGCTTCTTTCTTCACCATGTCACTTGCTGGGAAAATCACCACTGAAATTGGGGTTCATGCAACCGCTGCAAAGTGGTTCAACCTCTTTGCAACACAACTTCATCATGTTCAAAACCTTACTGATAGAGTACATGGAACCAAGCTGCATCAAGGTGAAGACTGGCATCACAACGAGACAGTCAAACACTGGACTTATACCATAGATGGTAAGGCTACAACATGTCTGGAGAGTATTGAATCCATTGATGAACAGAACAAAACAATCACCTACAAGCTCTTCAGTGGAGACATTGATCATAAGTATAAGAAATTTAAGTTCACCTTTCAAGCCATTGATAAGGATCAAGGCGGTGCTTTTATTAAATGGACGGTTGAATATGAAAGGCTTGCTGAGGAGGTTGATCCTCCATATGGATACATCGAATACCTGCACAAATGCACTAAAGATATTGATGTTCATCTTCTCAAAGCATAG
Predicted protein sequences of Glyma15g31520
>Glyma15g31520.1   sequence type=predicted peptide   gene model=Glyma15g31520   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVFLSHICSQYSSPSPIFVCSISCFLLLLLASFFTMSLAGKITTEIGVHATAAKWFNLFATQLHHVQNLTDRVHGTKLHQGEDWHHNETVKHWTYTIDGKATTCLESIESIDEQNKTITYKLFSGDIDHKYKKFKFTFQAIDKDQGGAFIKWTVEYERLAEEVDPPYGYIEYLHKCTKDIDVHLLKA*






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo