SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research



Report for Sequence Feature Glyma15g30610

Feature Type:gene_model
Chromosome:Gm15
Start:33916325
stop:33917472
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G44310AT Annotation by Michelle Graham. TAIR10: Calcium-binding EF-hand family protein | chr2:18309285-18309713 FORWARD LENGTH=142 SoyBaseE_val: 3.00E-67ISS
GO:0008150GO-bp Annotation by Michelle Graham. GO Biological Process: biological process SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005509GO-mf Annotation by Michelle Graham. GO Molecular Function: calcium ion binding SoyBaseN/AISS
UniRef100_B9REM6UniRef Annotation by Michelle Graham. Most informative UniRef hit: Calcium ion binding protein, putative n=1 Tax=Ricinus communis RepID=B9REM6_RICCO SoyBaseE_val: 1.00E-68ISS
UniRef100_I1MIA8UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1MIA8_SOYBN SoyBaseE_val: 6.00E-92ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g217700 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma15g30610.1   sequence type=CDS   gene model=Glyma15g30610   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGGTGTGGTGGTGATCGACGGCAGCACCGTGCGCGACTTCGTGAACGACGAGGCGGCCTTCGCGAAGAGCGTGGACGAGCAGTTCGGGGTGCTGGACCTCAACAACGACGGCGTCCTCTCGCGCTCGGAGCTCCGCACGGCCTTCGAGTCCATGCGCCTCATCGAGACGCACTTCGGCATCGACGTCGCCACGCCGCCGGATCAGCTCGCGAAGCTCTACGACTCCATCTTCGACAAGTTCGACGGCGACCGGAGCGGCGCCGTCGACCGCCGCGAGTTCCGGGATGAGATGAGGAAGATCATGCTCGCCATCGCCGACGGCCTCGGCTCCTTCCCCATCCGCATGGTCCTCGAGGATGATCCCAATAGTCTTCTTCAGAAAGCTGCAGATCTCGAAGCTTCCAAGACCTGA

>Glyma15g30610.1   sequence type=predicted peptide   gene model=Glyma15g30610   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MGVVVIDGSTVRDFVNDEAAFAKSVDEQFGVLDLNNDGVLSRSELRTAFESMRLIETHFGIDVATPPDQLAKLYDSIFDKFDGDRSGAVDRREFRDEMRKIMLAIADGLGSFPIRMVLEDDPNSLLQKAADLEASKT*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo