SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research


Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g30131): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g30131): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g30131

Feature Type:gene_model
Chromosome:Gm15
Start:33296726
stop:33297277
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g30131
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G17780AT Annotation by Michelle Graham. TAIR10: PLAC8 family protein | chr2:7725808-7726952 REVERSE LENGTH=314 SoyBaseE_val: 3.00E-26ISS
GO:0048528GO-bp Annotation by Michelle Graham. GO Biological Process: post-embryonic root development SoyBaseN/AISS
GO:0070509GO-bp Annotation by Michelle Graham. GO Biological Process: calcium ion import SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0003674GO-mf Annotation by Michelle Graham. GO Molecular Function: molecular function SoyBaseN/AISS
UniRef100_I1JIE5UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein n=1 Tax=Glycine max RepID=I1JIE5_SOYBN SoyBaseE_val: 2.00E-96ISS
UniRef100_Q3EBY6-4UniRef Annotation by Michelle Graham. Most informative UniRef hit: Isoform 4 of Protein MID1-COMPLEMENTING ACTIVITY 2 n=1 Tax=Arabidopsis thaliana RepID=Q3EBY6-4 SoyBaseE_val: 1.00E-23ISS

Expression Patterns of Glyma15g30131
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g30131 not represented in the dataset
Glyma15g30131 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g30131 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g217200 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g30131
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g30131
>Glyma15g30131.1   sequence type=CDS   gene model=Glyma15g30131   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGCAACATTTCAGCGAAGAGGATAAAAGGGAATATACTCTGGATGAAGAAGAAATGGAGACTCAAAATGTGATATTAAAGACTAGTCGATCTAAGAAGGATGCATGTATATTGGAGAAGTCCTTATCTCATAGGTATCCAGATTTGGTGTTCCACGAGGCCCTCAAAGAGGAGAAAGAAAAACTGCATGTTGAAATACGTAGATCAAGAACCAATAATGACCCGGAACAATGCAGGGTAATTGAGCATCTTATTGAAGTCACAAAAAATGTTGTCAACATGTCACCTAACAAAAAGGTTACAAAAATTGTTTTCAATGAACCAACTGATTTAATTGCAAGGCATATAACTGATAATGCAATAGGCTCTGAGGACCTTGAGTTGGAATCTGCATATAAAAGTCAATCAGAATGGAAGACTGATCTCTTTGGTTTCTGTAGGGATCCTTGCTTATGTAAATTT
Predicted protein sequences of Glyma15g30131
>Glyma15g30131.1   sequence type=predicted peptide   gene model=Glyma15g30131   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MQHFSEEDKREYTLDEEEMETQNVILKTSRSKKDACILEKSLSHRYPDLVFHEALKEEKEKLHVEIRRSRTNNDPEQCRVIEHLIEVTKNVVNMSPNKKVTKIVFNEPTDLIARHITDNAIGSEDLELESAYKSQSEWKTDLFGFCRDPCLCKF






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo