SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma15g29340

Feature Type:gene_model
Chromosome:Gm15
Start:32280081
stop:32281893
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Annotations for Glyma15g29340
Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT2G35630AT Annotation by Michelle Graham. TAIR10: ARM repeat superfamily protein | chr2:14966828-14980361 FORWARD LENGTH=1978 SoyBaseE_val: 7.00E-112ISS
GO:0000226GO-bp Annotation by Michelle Graham. GO Biological Process: microtubule cytoskeleton organization SoyBaseN/AISS
GO:0000910GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinesis SoyBaseN/AISS
GO:0000911GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinesis by cell plate formation SoyBaseN/AISS
GO:0006342GO-bp Annotation by Michelle Graham. GO Biological Process: chromatin silencing SoyBaseN/AISS
GO:0007017GO-bp Annotation by Michelle Graham. GO Biological Process: microtubule-based process SoyBaseN/AISS
GO:0007129GO-bp Annotation by Michelle Graham. GO Biological Process: synapsis SoyBaseN/AISS
GO:0007131GO-bp Annotation by Michelle Graham. GO Biological Process: reciprocal meiotic recombination SoyBaseN/AISS
GO:0009630GO-bp Annotation by Michelle Graham. GO Biological Process: gravitropism SoyBaseN/AISS
GO:0009920GO-bp Annotation by Michelle Graham. GO Biological Process: cell plate formation involved in plant-type cell wall biogenesis SoyBaseN/AISS
GO:0010564GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of cell cycle process SoyBaseN/AISS
GO:0016572GO-bp Annotation by Michelle Graham. GO Biological Process: histone phosphorylation SoyBaseN/AISS
GO:0051322GO-bp Annotation by Michelle Graham. GO Biological Process: anaphase SoyBaseN/AISS
GO:0051567GO-bp Annotation by Michelle Graham. GO Biological Process: histone H3-K9 methylation SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005819GO-cc Annotation by Michelle Graham. GO Cellular Compartment: spindle SoyBaseN/AISS
GO:0005874GO-cc Annotation by Michelle Graham. GO Cellular Compartment: microtubule SoyBaseN/AISS
GO:0009506GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasmodesma SoyBaseN/AISS
GO:0009524GO-cc Annotation by Michelle Graham. GO Cellular Compartment: phragmoplast SoyBaseN/AISS
GO:0009574GO-cc Annotation by Michelle Graham. GO Cellular Compartment: preprophase band SoyBaseN/AISS
GO:0030981GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cortical microtubule cytoskeleton SoyBaseN/AISS
GO:0008017GO-mf Annotation by Michelle Graham. GO Molecular Function: microtubule binding SoyBaseN/AISS
PTHR12609Panther MICROTUBULE ASSOCIATED PROTEIN XMAP215 JGI ISS
UniRef100_G7L960UniRef Annotation by Michelle Graham. Most informative UniRef hit: Centrosomal protein n=1 Tax=Medicago truncatula RepID=G7L960_MEDTR SoyBaseE_val: 1.00E-124ISS
UniRef100_I1MI83UniRef Annotation by Michelle Graham. Best UniRef hit: Uncharacterized protein (Fragment) n=1 Tax=Glycine max RepID=I1MI83_SOYBN SoyBaseE_val: 2.00E-142ISS

Expression Patterns of Glyma15g29340
Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g29340 not represented in the dataset
Glyma15g29340 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection 		Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g29340 Gene Call Version Wm82.a1.v1.1
Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g214600 Wm82.a2.v1IGC As supplied by JGI

References for Glyma15g29340
Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

Coding sequences of Glyma15g29340
>Glyma15g29340.1   sequence type=CDS   gene model=Glyma15g29340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGAGAAAGCGATAAAAAACAAAGTTGCTAAAGCGGTGGTACCTACAATAGATGTTATGTTTCAAGCTTTAAGTGATTTTGGAGCAAAAATTGTGCCCCCAAAAAGAATTTTGAAGATGCTTCCAGAACTCTTTGATCATCAAGATCAAAATGTTCGTGCATCCTCTAAAGGGTTGACTCTTGAACTTTGCCGTTGGATTGGTAAAGATAGTGTAAAATCAATTTTGTTTGAGACAATGAGAGACACAATGAAAAAAGAGCTAGAGGCAGAGCTTGTAAATGTTACAGGAACAACAAAGCCAACCCGTAAAATAAGATCTGAGCAAGATAAAGAACCTAACCAAGAAGCTGTGTCAGAGGTTGTGGGTCCTGGCCCTTCTGAAGAATCTGGGAATGATGCTCCTCAAGAAATCGATGAATATGAACTTGTTGATCCTGTTGATATATTGACTCCTTTAGAGAAGTCAGGATTTTGGGATGGAGTTAAACCTACCAAATGGTCTGAACAGAAGGAGGTTGTTGCTGATCTAACAAAGCTTGCATCAACTAAAAGAATTTCTCCTGGCGATTTCTCTGAAGTTTGTCGGACCTTAAAAAAGGTATAT
Predicted protein sequences of Glyma15g29340
>Glyma15g29340.1   sequence type=predicted peptide   gene model=Glyma15g29340   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MEKAIKNKVAKAVVPTIDVMFQALSDFGAKIVPPKRILKMLPELFDHQDQNVRASSKGLTLELCRWIGKDSVKSILFETMRDTMKKELEAELVNVTGTTKPTRKIRSEQDKEPNQEAVSEVVGPGPSEESGNDAPQEIDEYELVDPVDILTPLEKSGFWDGVKPTKWSEQKEVVADLTKLASTKRISPGDFSEVCRTLKKVY






Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo