SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research




Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g27600): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g27600): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g27600

Feature Type:gene_model
Chromosome:Gm15
Start:29999896
stop:30003583
Source:JGI
Version:Wm82.a1.v1.1
High confidence:yes



A newer version of this gene model can be found here:

Database IDAnnotation TypeAnnotation DescriptionAnnotation SourceMatch ScoreEvidence Code
AT3G48750AT Annotation by Michelle Graham. TAIR10: cell division control 2 | chr3:18072238-18074296 FORWARD LENGTH=294 SoyBaseE_val: 6.00E-89ISS
GO:0000278GO-bp Annotation by Michelle Graham. GO Biological Process: mitotic cell cycle SoyBaseN/AISS
GO:0000910GO-bp Annotation by Michelle Graham. GO Biological Process: cytokinesis SoyBaseN/AISS
GO:0006995GO-bp Annotation by Michelle Graham. GO Biological Process: cellular response to nitrogen starvation SoyBaseN/AISS
GO:0008284GO-bp Annotation by Michelle Graham. GO Biological Process: positive regulation of cell proliferation SoyBaseN/AISS
GO:0008356GO-bp Annotation by Michelle Graham. GO Biological Process: asymmetric cell division SoyBaseN/AISS
GO:0009409GO-bp Annotation by Michelle Graham. GO Biological Process: response to cold SoyBaseN/AISS
GO:0009555GO-bp Annotation by Michelle Graham. GO Biological Process: pollen development SoyBaseN/AISS
GO:0009793GO-bp Annotation by Michelle Graham. GO Biological Process: embryo development ending in seed dormancy SoyBaseN/AISS
GO:0010048GO-bp Annotation by Michelle Graham. GO Biological Process: vernalization response SoyBaseN/AISS
GO:0010440GO-bp Annotation by Michelle Graham. GO Biological Process: stomatal lineage progression SoyBaseN/AISS
GO:0040020GO-bp Annotation by Michelle Graham. GO Biological Process: regulation of meiosis SoyBaseN/AISS
GO:0042023GO-bp Annotation by Michelle Graham. GO Biological Process: DNA endoreduplication SoyBaseN/AISS
GO:0045736GO-bp Annotation by Michelle Graham. GO Biological Process: negative regulation of cyclin-dependent protein kinase activity SoyBaseN/AISS
GO:0048229GO-bp Annotation by Michelle Graham. GO Biological Process: gametophyte development SoyBaseN/AISS
GO:0005634GO-cc Annotation by Michelle Graham. GO Cellular Compartment: nucleus SoyBaseN/AISS
GO:0005737GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytoplasm SoyBaseN/AISS
GO:0005829GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cytosol SoyBaseN/AISS
GO:0005886GO-cc Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane SoyBaseN/AISS
GO:0009574GO-cc Annotation by Michelle Graham. GO Cellular Compartment: preprophase band SoyBaseN/AISS
GO:0010005GO-cc Annotation by Michelle Graham. GO Cellular Compartment: cortical microtubule, transverse to long axis SoyBaseN/AISS
GO:0004672GO-mf Annotation by Michelle Graham. GO Molecular Function: protein kinase activity SoyBaseN/AISS
GO:0004674GO-mf Annotation by Michelle Graham. GO Molecular Function: protein serine/threonine kinase activity SoyBaseN/AISS
GO:0004693GO-mf Annotation by Michelle Graham. GO Molecular Function: cyclin-dependent protein kinase activity SoyBaseN/AISS
GO:0005515GO-mf Annotation by Michelle Graham. GO Molecular Function: protein binding SoyBaseN/AISS
GO:0005524GO-mf Annotation by Michelle Graham. GO Molecular Function: ATP binding SoyBaseN/AISS
GO:0016301GO-mf Annotation by Michelle Graham. GO Molecular Function: kinase activity SoyBaseN/AISS
GO:0016772GO-mf Annotation by Michelle Graham. GO Molecular Function: transferase activity, transferring phosphorus-containing groups SoyBaseN/AISS
KOG0594 KOG Protein kinase PCTAIRE and related kinases JGI ISS
PTHR24056Panther CELL DIVISION PROTEIN KINASE JGI ISS
PF00069PFAM Protein kinase domain JGI ISS
UniRef100_A8VFL5UniRef Annotation by Michelle Graham. Most informative UniRef hit: CDC2 n=1 Tax=Glycine max RepID=A8VFL5_SOYBN SoyBaseE_val: 8.00E-91ISS
UniRef100_UPI000233B2CBUniRef Annotation by Michelle Graham. Best UniRef hit: UPI000233B2CB related cluster n=1 Tax=unknown RepID=UPI000233B2CB SoyBaseE_val: 0ISS

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g27600 not represented in the dataset

Glyma15g27600 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552.
Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection
Severin et al. 2010, BMC Plant Biology 10:160
RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Corresponding NameAnnotation VersionEvidenceComments
Glyma.15g211100 Wm82.a2.v1IGC As supplied by JGI

Schmutz et al. 2010
  Genome sequence of the palaeopolyploid soybean
  Nature 2010, 463:178-183

>Glyma15g27600.2   sequence type=CDS   gene model=Glyma15g27600   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGACGTGAAGATATTGGATGTGGCGGCGGAGGGCGGCTACGGGCGGGTGTTCCGGTGCCTCGACGTCCACACGGGCGCCCTCGTGGCCATGAAGCAGATCACGATGGTCAGGTTGAGCCAGGGCATTCCGGCGCAGATCATCCGGGAAGTGTCGCTCCTCAGAGAGCTCCACCACGCCAACATCGTGAAGCTGCTCAGGGTAGGGTTCACAGAGAACAGGTACGTCAACCTCGTCTTCGAGCATCTCGATTACGACCTTCATCAGTTCATTGTCAACCGAGGTTACCCCAAGGATGCCACCACTGTGAAGAGTTTCATGTTCCAGATACTCTCTGCTGTGGCTTACTGTCACTCGCGGAAGGTTCTGCACAGAGATTTGAAACCAAGCAATGTACTGATCAATCATTCCAAAAGGTTGATCAAACTAGCAGATTTCGGTTTGGCTAGAGAGTTTGCAGATGACTTTTTATATACTGAGAAGTTAGGAACTTCCTGGTATAGGGCACCTGAAATATTGTGCCACTCCAGACAATATTCAACTCAAGTTGATTTGTGGTCTGTTGGCTGCATATTTGCTGAGATGGTAATTGGACAACCTTTATTCCAAGTTATTAATTGCCGGGATGAATTGGAGGGGATTTTCAAATTGTTAGGTACCCCCACAGAGGAAACATGGCCAGGAATCACTAAATTAATGCCTAACCTTCATATCTACTGCTCCAAATTTGATCCATTGGGCCTGGAAACATTTGTTACTGATCTGGAACCAAGTGGCCTGAATCTACTATCAATGATGCTATGCTTGGACCCAAGTAAAAGGATTTCTGCGGAAGCTTCTCTAAAGCATGCTTACTTTACAGATGTGAATTGGATTTAG

>Glyma15g27600.2   sequence type=predicted peptide   gene model=Glyma15g27600   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MDVKILDVAAEGGYGRVFRCLDVHTGALVAMKQITMVRLSQGIPAQIIREVSLLRELHHANIVKLLRVGFTENRYVNLVFEHLDYDLHQFIVNRGYPKDATTVKSFMFQILSAVAYCHSRKVLHRDLKPSNVLINHSKRLIKLADFGLAREFADDFLYTEKLGTSWYRAPEILCHSRQYSTQVDLWSVGCIFAEMVIGQPLFQVINCRDELEGIFKLLGTPTEETWPGITKLMPNLHIYCSKFDPLGLETFVTDLEPSGLNLLSMMLCLDPSKRISAEASLKHAYFTDVNWI*







Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA
 
USDA Logo
Iowa State University Logo