Glyma15g27571 - SoyBase

SoyBase SoyBase transitions to NEW site on 10/1/2024
Integrating Genetics and Genomics to Advance Soybean Research

Warning: Undefined variable $sxsome in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $sstart in /var/www/html/include/SeqFeatClass.php on line 665

Warning: Undefined variable $send in /var/www/html/include/SeqFeatClass.php on line 665

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean/Absolute/Glyma15g27571): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1018

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1019

Warning: get_headers(): php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: get_headers(https://bar.utoronto.ca/api/efp_image/efp_soybean/soybean_severin/Absolute/Glyma15g27571): Failed to open stream: php_network_getaddresses: getaddrinfo for bar.utoronto.ca failed: Temporary failure in name resolution in /var/www/html/include/SeqFeatClass.php on line 1020

Warning: Trying to access array offset on false in /var/www/html/include/SeqFeatClass.php on line 1021

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1025

Deprecated: preg_match(): Passing null to parameter #2 ($subject) of type string is deprecated in /var/www/html/include/SeqFeatClass.php on line 1031

Report for Sequence Feature Glyma15g27571

Feature Type:	gene_model
Chromosome:	Gm15
Start:	29843442
stop:	29845879
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma15g27571

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G54500	AT	Annotation by Michelle Graham. TAIR10: flavodoxin-like quinone reductase 1 \| chr5:22124674-22126256 FORWARD LENGTH=204	SoyBase	E_val: 7.00E-57	ISS
GO:0006970	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to osmotic stress	SoyBase	N/A	ISS
GO:0009733	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to auxin stimulus	SoyBase	N/A	ISS
GO:0045892	GO-bp	Annotation by Michelle Graham. GO Biological Process: negative regulation of transcription, DNA-dependent	SoyBase	N/A	ISS
GO:0046686	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to cadmium ion	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0005576	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: extracellular region	SoyBase	N/A	ISS
GO:0005773	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuole	SoyBase	N/A	ISS
GO:0005774	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: vacuolar membrane	SoyBase	N/A	ISS
GO:0005886	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: plasma membrane	SoyBase	N/A	ISS
GO:0016020	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: membrane	SoyBase	N/A	ISS
GO:0010181	GO-mf	Annotation by Michelle Graham. GO Molecular Function: FMN binding	SoyBase	N/A	ISS
GO:0016491	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity	SoyBase	N/A	ISS
GO:0016655	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor	SoyBase	N/A	ISS
KOG3135	KOG	1,4-benzoquinone reductase-like; Trp repressor binding protein-like/protoplast-secreted protein	JGI		ISS
UniRef100_A3F7Q3	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Benzoquinone reductase n=2 Tax=Malvoideae RepID=A3F7Q3_GOSHI	SoyBase	E_val: 2.00E-57	ISS
UniRef100_UPI000233B469	UniRef	Annotation by Michelle Graham. Best UniRef hit: UPI000233B469 related cluster n=1 Tax=unknown RepID=UPI000233B469	SoyBase	E_val: 8.00E-70	ISS

Expression Patterns of Glyma15g27571

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology

Glyma15g27571 not represented in the dataset	Glyma15g27571 not represented in the dataset
Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Gene model name correspondences to Glyma15g27571 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.15g210700	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma15g27571

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma15g27571

Limit To All Plant Sequences

>Glyma15g27571.1   sequence type=CDS   gene model=Glyma15g27571   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGCCGTCCAAGTTTATATTGCGTACTACTCATTGTACGGACATGTGGAGAGACTAGCAGAAGAAATAAAGAAAGGAACCAATTGTGTTGAAGGCGTTGAGGCCAAACTATGGCAGTTTAAAGCCTTTCTAGATGCAAGCGGAGGTTTATGGGAAACACAACAACTTGCAGGCAAACTTGTTGGAATCTTCTACAGCACCAGATCCCAAGGTGTGTCTTTAAGGAAGATCTTACGGAATATTAATGATGAGAAATTGTGGGATGAGTATGCCTGGCTTACTGCTATAGCTCAACCGGTTCATCATGGAATGTTATTTGTTCCAATTGGATACACATTTAGTGCTGGAATGTTCGAGATGGAGGAACTAAAAGGTGGTAGTCCATATGGTTCCGTGCTTGAGCTGGAGCAAGCATTCCACCAAGGCAAGTATATCGCCAACATCACAAAGAAGCTCAAGGAAGCTGCATAA

Predicted protein sequences of Glyma15g27571

Limit To All Plant Sequences

>Glyma15g27571.1   sequence type=predicted peptide   gene model=Glyma15g27571   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MAVQVYIAYYSLYGHVERLAEEIKKGTNCVEGVEAKLWQFKAFLDASGGLWETQQLAGKLVGIFYSTRSQGVSLRKILRNINDEKLWDEYAWLTAIAQPVHHGMLFVPIGYTFSAGMFEMEELKGGSPYGSVLELEQAFHQGKYIANITKKLKEAA*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain